Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 75 of 162|Showing 3701-3750 of 8072
mammoth.bio favicon

Mammoth Biosciences

mammoth.bio

66
HealthcareUnited StatesmediumMEDIUM

Mammoth Biosciences is a biotechnology company specializing in developing in vivo gene editing therapeutics, protein discovery, and CRISPR-based diagnostics. The company leverages novel CRISPR-Cas enzymes and innovative technologies to address unmet patient needs in genetic medicine. With a distinguished team including co-founder Jennifer Doudna, Mammoth Biosciences positions itself as an innovative leader in the gene editing space. The website reflects a professional and consistent brand image targeting biotech professionals, healthcare partners, and potential employees. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Google Analytics. It employs Google reCAPTCHA for form security and uses jQuery and Slick Slider for interactive elements. The site is mobile optimized and SEO friendly, though some accessibility features could be improved. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS and uses reCAPTCHA, but lacks explicit security headers and publicly available security or incident response policies. WHOIS data is privacy protected, which is common for biotech firms but limits transparency. No cookie consent mechanism was detected, which may impact GDPR compliance. Overall, Mammoth Biosciences' website is trustworthy, professional, and content-rich, supporting its business credibility. Strategic improvements in security headers, privacy compliance, and transparency would enhance its security posture and regulatory adherence.

30
58
25
75
72
85
100
crisprgeneeditingbiotechnologyhealthcarediagnostics+1 more
WordPressYoast SEOGoogle AnalyticsjQuery+2
2025-09-06T00:50:22.593Z
ledger.com favicon

Ledger

ledger.com

71
TechnologyN/alargeMEDIUM

Ledger is a leading technology company specializing in cryptocurrency security solutions, primarily through hardware wallets and associated software services. Their market position is strong within the crypto asset protection sector, offering products such as Ledger Nano X, Nano S Plus, Ledger Stax, and Ledger Flex, alongside software like Ledger Live and services including Ledger Recover and a crypto payment card. The company targets cryptocurrency users, DeFi participants, and Web3 enthusiasts, providing secure and user-friendly solutions to safeguard digital assets. Technically, Ledger's website is built on a modern WordPress CMS with integrations of advanced analytics and marketing tools such as Google Tag Manager and Optimizely. The site demonstrates excellent performance, mobile optimization, and SEO practices, reflecting a mature digital infrastructure. Security measures include HTTPS enforcement, comprehensive security headers, and published security policies, indicating a robust security posture. The security evaluation reveals strong adherence to best practices, including ISO 27001 certification and incident response readiness. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well-managed with clear privacy and cookie policies and active consent mechanisms, aligning with GDPR requirements. However, the absence of WHOIS data for the domain is unusual and warrants further verification, though the overall trust indicators and branding consistency support the legitimacy of the site. Overall, Ledger presents a professional, secure, and trustworthy online presence with a strong focus on protecting cryptocurrency assets. Strategic recommendations include publishing a security.txt file to facilitate vulnerability disclosures and enhancing transparency around data retention policies to further strengthen privacy compliance.

30
88
10
100
75
80
100
cryptocurrencyhardwarewalletsecuritydefiweb3+2 more
WordPressYoast SEOjQueryOptimizely+2

Partner Domains:

shop.ledger.com
partner
2025-09-05T23:39:53.400Z
delaplainefoundation.org favicon

Delaplaine Foundation, Inc.

delaplainefoundation.org

54
Non-profitUnited StatessmallMEDIUM

Delaplaine Foundation, Inc. is a private family foundation based in Frederick, Maryland, focused on philanthropic giving to enrich communities and families. The foundation supports programs in arts, education, health, human services, historical preservation, and spiritual enlightenment primarily in Frederick County and surrounding areas. It operates as a small non-profit entity with a legacy dating back to 2003, positioning itself as a leader in local philanthropic efforts. The website provides clear information about grant application processes, deadlines, and sponsorship protocols, targeting nonprofit organizations and community stakeholders. Technically, the website is built on WordPress with modern plugins such as Smart Slider 3 and Yoast SEO, indicating a moderate level of digital maturity. The site is mobile optimized and uses Google Analytics and StatCounter for visitor tracking. Hosting is provided by Hostopia Canada Corp, and the domain is longstanding and stable. However, there are gaps in privacy compliance, as no explicit privacy or cookie policies are found, and security headers are missing. DNSSEC is not enabled, which could improve domain security. From a security perspective, the site uses HTTPS and does not expose sensitive data or vulnerable libraries visibly. There is no evidence of incident response or vulnerability disclosure policies, which are recommended for improved security posture. Overall, the site is professional and trustworthy but could enhance compliance and security practices. The overall risk assessment is moderate with recommendations to implement privacy and cookie policies, enable DNSSEC, add security headers, and provide incident response information to strengthen trust and security culture.

15
35
17
75
42
65
100
non-profitphilanthropyfoundationgrantscommunity+2 more
WordPressjQuerySmart Slider 3Yoast SEO+2
2025-09-05T23:37:16.910Z
rooseveltinstitute.org favicon

Roosevelt Institute

rooseveltinstitute.org

62
Non-profitUnited StatesmediumMEDIUM

The Roosevelt Institute is a well-established non-profit think tank founded in 2007, dedicated to advancing progressive economic and democratic reforms inspired by the legacy of Franklin and Eleanor Roosevelt. The organization operates through policy research, leadership development programs such as the Roosevelt Network, and public education initiatives. Their website reflects a mature digital presence with comprehensive content, clear navigation, and consistent branding, targeting policymakers, researchers, advocates, and students interested in progressive policy solutions. Technically, the site is built on WordPress with modern plugins and tools including Yoast SEO, Google Tag Manager, and CookiePro for consent management. The site is mobile-optimized and accessible, with good SEO practices and moderate performance. Security is generally strong with HTTPS enforced and domain transfer protections, though improvements such as DNSSEC and explicit security policies could enhance their posture. From a security perspective, the site shows no signs of vulnerabilities or malicious content. However, the absence of a published privacy policy and terms of service pages in the analyzed content is a gap in compliance and transparency. Cookie consent is implemented, indicating GDPR awareness. No incident response or vulnerability disclosure information is present, which could be improved to strengthen trust. Overall, the Roosevelt Institute website is professional, trustworthy, and well-aligned with its mission. Strategic recommendations include publishing comprehensive privacy and security policies, enabling DNSSEC, and providing clear incident response contacts to enhance security and compliance further.

15
88
2
80
52
80
100
non-profitthinktankpolicyresearcheconomicreformdemocracy+2 more
WordPressjQueryGoogle Tag ManagerYoast SEO+3

Partner Domains:

support.rooseveltinstitute.org
service
fdrlibrary.org
partner
2025-09-05T17:58:09.103Z
izooto.com favicon

iZooto

izooto.com

64
TechnologyN/amediumMEDIUM

iZooto is a technology company specializing in audience marketing platforms tailored for publishers. Their platform offers a comprehensive suite of services including web and app push notifications, personalized notification inbox (News Hub), on-site interactions, email newsletters, audience segmentation, automation, personalization, and detailed reporting and analytics. Positioned as a market leader, iZooto targets digital content publishers aiming to engage and monetize their audiences effectively across devices. The company was founded in 2015 and maintains a consistent brand presence with a professional website and active social media channels. Technically, the website is built on WordPress using Elementor and Yoast SEO plugins, leveraging modern JavaScript libraries and integrations such as Google Tag Manager, Microsoft Clarity, Zoho SalesIQ, and Google DoubleClick for advertising. The site is hosted with Cloudflare DNS and uses HTTPS with a good SSL configuration. Performance and mobile optimization are good, though accessibility features are basic. SEO is well implemented with proper meta tags and structured data. From a security perspective, the site uses HTTPS and has domain transfer protections enabled. However, it lacks visible security headers and published security policies or incident response contacts. No vulnerability disclosure or security.txt files were found. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms on the analyzed content. Analytics usage is moderate with multiple tracking services, but privacy compliance could be improved. Overall, iZooto presents a credible and professional online presence with a solid technical foundation and market positioning. The main risks relate to privacy compliance and security transparency, which should be addressed to enhance trust and regulatory adherence.

30
65
17
85
52
85
100
audiencemarketingpushnotificationspublisherssaasdigitalmarketing+5 more
WordPressElementorYoast SEOjQuery+6
2025-09-05T13:19:44.754Z
khaama.com favicon

The Khaama Press News Agency

khaama.com

73
MediaAfghanistanmediumMEDIUM

Khaama Press is an independent news agency focused on delivering reliable news from Afghanistan and around the world. It covers a broad range of topics including politics, security, business, refugee issues, and women's rights. The website positions itself as Afghanistan's leading independent news source, targeting a general audience interested in regional and global news. The business model revolves around news reporting and information dissemination, supported by advertising and donations. Technically, the website is built on WordPress with modern web technologies such as jQuery, Google Fonts, and Yoast SEO for search optimization. It uses Google reCAPTCHA for form security and Google Tag Manager for analytics. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms. However, some security headers are missing, and there is no security.txt or vulnerability disclosure page. Privacy compliance is partial, with a privacy policy and terms of use present but lacking a cookie consent mechanism. The WHOIS data is missing, which raises concerns about domain legitimacy, though the website content and social media presence support its credibility. Overall, Khaama Press is a professional and trustworthy news platform with room for improvement in security and privacy compliance. The absence of WHOIS data is a notable risk factor that should be monitored. Strategic recommendations include enhancing security headers, implementing cookie consent, and establishing a vulnerability disclosure process.

95
53
17
85
77
85
100
newsafghanistanmediapoliticsbusiness+3 more
WordPressjQueryGoogle FontsYoast SEO+3
2025-09-05T12:05:33.191Z
phonandroid.com favicon

PhonAndroid

phonandroid.com

67
MediaFrancelargeMEDIUM

PhonAndroid is a prominent French-language technology news and media website specializing in Android and high-tech topics. It provides a wide range of content including news, product reviews, buying guides, tutorials, and community forums. The site targets French-speaking technology enthusiasts and consumers interested in the latest developments in mobile and related technologies. Affiliated with CCM Benchmark Group, PhonAndroid holds a strong market position in the French tech media landscape. Technically, the website is built on WordPress and leverages common web technologies such as jQuery, Google Tag Manager, and Disqus for comments. It employs SEO best practices including structured data (JSON-LD) and meta tags, and is optimized for mobile devices with good performance. The site uses HTTPS and includes GDPR-compliant privacy and cookie policies with consent mechanisms, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and manages third-party scripts through Google Tag Manager, but lacks explicit security headers and incident response contact information. No critical vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data limits domain trust assessment, but the affiliation with a reputable parent company supports legitimacy. Overall, PhonAndroid presents a professional, content-rich, and user-friendly platform with moderate to good security and privacy compliance. Strategic improvements in security headers, incident response transparency, and WHOIS data availability would further enhance trust and resilience.

30
65
17
87
75
80
100
technologyandroidhigh-technewsreviews+3 more
WordPressjQueryGoogle Tag ManagerGoogle Analytics+3

Partner Domains:

ccmbg.com
parent
2025-09-05T09:47:27.722Z
profoundlogic.com favicon

Profound Logic

profoundlogic.com

66
TechnologyN/amediumMEDIUM

Profound Logic is a specialized technology company focused on transforming IBM i (AS/400) legacy systems into modern, AI-enhanced platforms. With over 25 years of experience, they provide a comprehensive suite of solutions including transformation tools, AI integration, development services, and API integration. Their market position is that of an established niche player serving IT teams and businesses reliant on IBM i systems, helping them modernize while preserving critical business logic. The website reflects a mature digital presence with professional design, clear messaging, and extensive content about their offerings. Technically, the website is built on WordPress using Elementor and integrates multiple analytics and marketing tools such as Google Analytics, HubSpot, Facebook Pixel, and Hotjar. The site is mobile-optimized, accessible, and SEO-friendly. Security posture is good with HTTPS enforced and no obvious vulnerabilities, though some security headers could be improved. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The WHOIS data is notably missing or unavailable, which raises some concerns about domain registration transparency. However, the website content and business information appear consistent and professional, mitigating some trust concerns. No WAF or blocking mechanisms were detected, allowing full content access and analysis. Overall, Profound Logic presents a credible and professional business with a strong focus on IBM i modernization and AI futurization, supported by a technically sound and user-friendly website. Some improvements in security headers and domain registration transparency are recommended to enhance trust and security posture.

30
80
17
70
77
75
100
ibmias400legacymodernizationaisoftwaredevelopment+2 more
WordPressElementorYoast SEOGoogle Analytics+6

Partner Domains:

profoundlogicsupport.atlassian.net
service
2025-09-05T09:45:12.058Z
infonline.de favicon

INFOnline GmbH

infonline.de

62
MediaGermanymediumMEDIUM

INFOnline GmbH is a medium-sized German company specializing in digital audience measurement services for publishers, joint industry committees, brands, and agencies. They provide a proprietary, privacy-compliant measurement system that is recognized as a technical standard in Germany and Austria. Their offerings include digital audience measurement, publishing benchmarks, project and stakeholder management, and software development, supported by a strong customer service infrastructure. The company emphasizes data privacy compliance with GDPR and TTDSG regulations and operates with a professional, well-structured website that reflects their market position and expertise. Technically, the website is built on WordPress using Elementor and integrates modern technologies such as HubSpot forms, Usercentrics for cookie consent, and various JavaScript libraries. The site is well-optimized for SEO, mobile-friendly, and accessible. Security practices include HTTPS enforcement and consent management, though some security headers could be improved. No vulnerabilities or exposed sensitive data were detected. The security posture is solid with good privacy compliance, but the absence of explicit security policies and incident response contacts suggests room for enhancement. The WHOIS data is privacy-protected as per DENIC policies, which is typical for German domains, and the domain appears legitimate and consistent with the business claims. Overall, INFOnline GmbH presents a trustworthy, professional digital presence with strong compliance and technical maturity. Strategic recommendations include enhancing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen trust and security posture.

30
55
17
85
52
70
100
digitalaudiencemeasurementpublishingbenchmarkdataprivacygdprmediameasurement+2 more
WordPressElementorYoast SEOHubSpot Forms+5
2025-09-05T08:38:57.983Z
myyu.ca favicon

Yorkville University

myyu.ca

55
EducationCanadamediumMEDIUM

Yorkville University operates the MyYU portal as a digital access point for its students and university community. The website serves as a login gateway and informational hub, reflecting the university's presence across multiple Canadian provinces. The business is positioned as a medium-sized educational institution with a focus on providing accessible higher education services. The website's content and branding are consistent with the university's identity, targeting students and academic stakeholders. Technically, the site is built on WordPress using Elementor and several popular plugins, with Cloudflare DNS services and SSL properly configured, indicating a modern and secure infrastructure. However, DNSSEC is not enabled, and some security headers are missing, suggesting room for improvement in security hardening. Privacy compliance is partially addressed with a comprehensive privacy policy linked on the main university domain, but cookie consent mechanisms are absent. No incident response or security policy pages were found, which could be enhanced to improve trust and compliance. Overall, the website is professional, secure, and trustworthy, with moderate user tracking via Google Tag Manager. The domain registration data aligns well with the business, supporting legitimacy and operational consistency.

15
53
2
40
75
70
100
educationuniversitystudentportalyorkvilleuniversitywordpress+1 more
WordPressElementorYoast SEOModern Events Calendar+3
2025-09-05T08:35:59.358Z
iab.net favicon

IAB

iab.net

74
MediaN/alargeMEDIUM

The Interactive Advertising Bureau (IAB) is a leading global trade association that empowers the media and marketing industries to thrive in the digital economy. The organization provides a broad range of services including standards development, advocacy, research, education, and events to support its members and the wider industry. The website reflects a mature digital presence with comprehensive content targeting media and marketing professionals. It serves as a hub for industry guidelines, best practices, training, and market intelligence. Technically, the website is built on WordPress and leverages a modern technology stack including Yoast SEO, Google Tag Manager, OneTrust for cookie consent, and various JavaScript libraries for UI and analytics. The site is mobile-optimized, accessible, and SEO-friendly, indicating a high level of digital maturity. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS, implements standard security headers, and uses cookie consent mechanisms aligned with GDPR. However, there is no publicly available security policy or incident response information, and no vulnerability disclosure program is evident. No critical vulnerabilities or exposed sensitive data were detected in the analysis. Overall, the website presents a professional and trustworthy digital front for the IAB organization. The lack of WHOIS data is likely due to privacy protection, which is justified for this type of entity. Strategic recommendations include publishing a formal security policy, incident response contacts, and a vulnerability disclosure program to enhance transparency and trust.

95
100
17
70
47
80
100
digitaladvertisingmediamarketingindustryassociationprivacy+3 more
WordPressYoast SEOGoogle Tag ManagerGoogle Analytics+8

Partner Domains:

iabtechlab.com
partner
2025-09-05T08:33:37.723Z
colorcommnetwork.com favicon

ColorComm Network

colorcommnetwork.com

57
MediaN/amediumMEDIUM

ColorComm Network is a professional membership and event platform focused on advancing women of color in the communications, marketing, advertising, media, and digital industries. The website positions itself as a leading national platform with a strong emphasis on diversity and inclusion. The business model centers on membership subscriptions and hosting professional programming events to foster networking and career growth. The company maintains an active social media presence and partners with notable organizations, enhancing its market position. Technically, the website is built on WordPress with WooCommerce integration, leveraging common libraries such as jQuery and Bootstrap. The site demonstrates good mobile optimization and SEO practices, though performance is moderate. The presence of privacy policy and GDPR-related scripts indicates some compliance awareness, but lacks a cookie consent mechanism. From a security perspective, the site enforces HTTPS and uses standard security practices but lacks important security headers and published security policies. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of WHOIS data for the domain is a concern, potentially indicating privacy protection or data retrieval issues, which slightly impacts trustworthiness. Overall, the website is professional and trustworthy with room for improvement in security posture and privacy compliance. Strategic enhancements in security headers, cookie consent, and domain registration transparency would strengthen the site's credibility and compliance.

15
70
2
70
42
75
100
womendiversityinclusioncommunicationsmarketing+4 more
WordPressWooCommercejQueryBootstrap+3
2025-09-05T06:23:43.800Z
newsguardtech.com favicon

NewsGuard

newsguardtech.com

68
TechnologyUnited StatesmediumMEDIUM

NewsGuard Technologies, Inc. operates as a global leader in information reliability, providing tools and services to counter misinformation for a broad audience including enterprises, digital platforms, advertisers, and consumers. Their offerings include news reliability ratings, false claim tracking, AI safety suites, and media intelligence dashboards, positioning them strongly in the technology and media sectors. The company maintains a professional and comprehensive web presence with multilingual support and extensive privacy and cookie policies, reflecting a mature digital infrastructure. Technically, the website is built on WordPress with modern SEO and analytics integrations such as Yoast SEO, New Relic, Google Tag Manager, and LinkedIn Insight Tag. The site demonstrates excellent performance, mobile optimization, and accessibility, supported by HTTPS and consent management mechanisms. However, explicit security headers and incident response policies are not visible, suggesting areas for improvement in security transparency. From a security perspective, the site employs HTTPS and cookie consent but lacks publicly disclosed security policies or vulnerability disclosure mechanisms. The absence of WHOIS data reduces transparency about domain ownership, although the professional site content and branding indicate legitimacy. No WAF or blocking mechanisms were detected, and no vulnerabilities were apparent in the HTML content. Overall, NewsGuard presents a trustworthy and professional digital presence with strong content quality and technical implementation. Strategic enhancements in security policy disclosure and domain registration transparency would further strengthen their security posture and trustworthiness.

25
83
2
70
100
75
100
mediainformationreliabilitymisinformationnewsratingsaisafety+3 more
WordPressYoast SEOjQueryNew Relic Browser Agent+3
2025-09-04T23:23:00.085Z
fraudblocker.com favicon

Fraud Blocker

fraudblocker.com

65
TechnologyUnited StatessmallMEDIUM

Fraud Blocker is a small technology company specializing in click fraud protection software designed to save advertisers money by blocking fraudulent clicks on Google Ads. The company positions itself as a leading provider in this niche, targeting advertisers and digital marketing agencies seeking to improve ad campaign efficiency. Founded in 2019, the business leverages a SaaS model to deliver proprietary fraud detection technology. The website reflects a professional and consistent brand image with good content quality and clear messaging focused on its core services. Technically, the website is built on WordPress using the GeneratePress theme and Elementor page builder, incorporating modern SEO and analytics tools such as Yoast SEO and Google Tag Manager. Hosting and DNS services involve Cloudflare, enhancing performance and security. The site is mobile-optimized and performs moderately well, though accessibility features are basic. Security posture is solid with HTTPS enabled and domain registration locked against unauthorized changes, but DNSSEC is not enabled, and no explicit security or incident response policies are published. From a security and compliance perspective, the site lacks visible privacy, cookie, and terms of service policies, which impacts privacy compliance scores. No vulnerability disclosure or security.txt files are present, and no data protection officer contact is provided. Contact information is clearly available, including a company email and phone number, along with active social media profiles. Overall, the site is safe, professional, and trustworthy, with no adult or questionable content detected. The overall risk assessment is moderate with recommendations to improve privacy compliance by publishing policies and implementing cookie consent, enabling DNSSEC, and adding security and incident response documentation to enhance trust and regulatory adherence.

25
80
2
72
75
85
100
clickfraudfrauddetectionadvertisinggoogleadsdigitalmarketing+2 more
WordPressElementorYoast SEOGoogle Tag Manager+1
2025-09-04T23:21:49.896Z
amobee.com favicon

Amobee

amobee.com

64
TechnologyN/aenterpriseMEDIUM

Amobee operates as a leading global advertising technology platform that unifies TV, programmatic, digital, and social advertising channels. The company targets advertisers and broadcasters seeking integrated marketing solutions to optimize and grow their business impact. The website reflects a mature enterprise with a comprehensive suite of services including discovery, planning, activation, optimization, and analytics. Technically, the site is built on WordPress with modern marketing and analytics tools such as Google Tag Manager, reCAPTCHA Enterprise, and OneTrust for privacy compliance. The site is well-optimized for SEO and mobile devices, with a professional design and clear navigation. Security posture is strong with HTTPS enforced and consent management implemented, though some HTTP security headers and explicit security policies are not publicly disclosed. The absence of WHOIS data is a notable gap, reducing trust slightly, but the overall digital presence and branding indicate a legitimate and professional business. Strategic recommendations include publishing security and incident response policies, implementing security.txt, and enhancing header security. Overall, the website presents a secure, compliant, and business credible platform with room for transparency improvements.

60
80
17
75
42
60
100
advertisingmarketingtechnologyprogrammaticdigital+3 more
WordPressjQueryGoogle Tag ManagerGoogle reCAPTCHA Enterprise+2
2025-09-04T22:13:37.572Z