Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

150016
Websites
130
Industries
113
Countries
52
Avg Score
Page 2773 of 3001|Showing 138601-138650 of 150016
hubbstergroup.com favicon

Hubbster Group AB

hubbstergroup.com

45
OtherSwedenmediumHIGH

Hubbster Group AB is a Swedish company specializing in data-driven feedback systems focused on customer, employee, and market experience. They provide a combination of SaaS survey tools and consulting services to help businesses make informed decisions and improve their operations. The company targets B2B clients primarily in Sweden and positions itself as a leading provider in its market segment. Their website is professionally designed, mobile-optimized, and includes clear navigation and relevant content that highlights their key services and client base. Technically, the website uses a modern but straightforward technology stack including jQuery, Slick Slider, and HubSpot marketing and analytics tools. It is built on the WebbEss CMS platform and employs HTTPS with good SSL configuration. The site loads with moderate performance and includes accessibility and SEO best practices, although some accessibility features could be improved. The presence of HubSpot scripts indicates a mature marketing automation and analytics setup. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious elements were detected in the HTML content. Privacy compliance is supported by a privacy policy and cookie consent mechanism, with GDPR compliance implied by the Swedish market focus and policy presence. Overall, the website presents a trustworthy and professional image with a solid business foundation. Security posture is adequate but could be enhanced by adding security headers and formal policies. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include improving security headers, publishing incident response information, and enhancing accessibility to further strengthen trust and compliance.

15
25
-
70
-
65
100
feedbackcustomerexperienceemployeesurveysmarketresearchconsulting+2 more
jQuery 3.5.1Slick SliderHubSpot scriptsCSS Vars Ponyfill (for IE support)
2025-06-18T08:56:10.906Z
msci.com favicon

MSCI Inc.

msci.com

60
FinanceUnited StatesenterpriseMEDIUM

MSCI Inc. is a leading global provider of data, analytics, and technology solutions designed to support investment decision-making across private assets, wealth management, sustainability, indexes, and risk management. The company targets investment professionals and asset managers, offering integrated tools and insights to enhance portfolio performance and risk assessment. MSCI maintains a strong market position with a comprehensive suite of services and a professional, user-friendly website that reflects its enterprise-level stature. Technically, the website leverages modern frameworks such as React and Next.js, with integrations for analytics and consent management including Google Tag Manager and OneTrust. The site demonstrates excellent performance, mobile optimization, and accessibility, supported by a robust content management system likely based on Adobe Experience Manager. Security best practices are observed with HTTPS enforcement, security headers, and no visible vulnerabilities. The security posture is strong, though explicit security policies and incident response contacts are not publicly detailed. Privacy compliance is well-managed with clear privacy and cookie policies and consent mechanisms. The website exhibits high professionalism and trustworthiness, supported by consistent branding and legal disclosures. Overall, MSCI's digital presence is mature and secure, supporting its business credibility and market leadership. Strategic recommendations include publishing detailed security policies and incident response information to further enhance transparency and trust.

50
63
5
85
-
85
100
sustainabilityprivateassetswealthriskclimate+3 more
ReactNext.jsGoogle Tag ManagerOneTrust+3
2025-06-18T08:56:10.774Z
jatc.se favicon

JATC Community Health Care

jatc.se

44
HealthcareSwedenmediumHIGH

JATC Community Health Care is a Swedish healthcare and social care provider specializing in services for young people and adults with neuropsychiatric diagnoses. The company offers a comprehensive range of services including group homes, service accommodation, daily activities, leisure programs, and dog daycare. Their market position is strengthened by multiple awards and recognitions, reflecting a reputable and expanding organization. The website is professionally designed, multilingual, and provides clear contact information and social media presence, supporting strong engagement with their target audience. Technically, the website is built on the Webnode CMS platform, leveraging Amazon Cloudfront CDN for hosting static assets and employing modern web technologies such as Google Tag Manager and Google Analytics for tracking. The site demonstrates good performance, mobile optimization, and accessibility features, contributing to a positive user experience. From a security perspective, the site enforces HTTPS with excellent SSL configuration and includes cookie consent mechanisms aligned with GDPR requirements. However, explicit security policies, incident response information, and vulnerability disclosure mechanisms are absent, representing areas for improvement. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy and professional digital presence with moderate to strong security and privacy compliance. Strategic enhancements in security transparency and incident response readiness would further strengthen their posture and stakeholder confidence.

35
-
5
70
-
60
100
healthcaresocialcareneuropsychiatricsupportaccommodationdogdaycare+2 more
Google Tag ManagerGoogle Analytics (gtag.js)Cloudfront CDNWebnode CMS+2
2025-06-18T08:56:10.577Z
sdiptech.com favicon

Sdiptech AB

sdiptech.com

51
EnergySwedenmediumMEDIUM

Sdiptech AB is a Sweden-based infrastructure technology group specializing in niche solutions that enhance societal efficiency, sustainability, and safety. The company operates across key sectors including supply chain and transportation, energy and electrification, water and bioeconomy, and safety and security. Their business model focuses on acquiring and developing technology companies that contribute to infrastructure development, targeting investors, entrepreneurs, and infrastructure stakeholders. The website reflects a professional and consistent brand presence with bilingual support for English and Swedish audiences. Technically, the website is built on the Webflow CMS platform, leveraging modern web technologies such as jQuery and Google Analytics for tracking. Hosting is provided via Amazon CloudFront CDN, ensuring moderate performance and good mobile optimization. The site includes cookie consent mechanisms compliant with GDPR, though some security headers and explicit security policies are not publicly visible. From a security perspective, the site uses HTTPS and implements an opt-in cookie consent banner, indicating a reasonable privacy posture. However, there is room for improvement in publishing security policies, incident response contacts, and vulnerability disclosure information. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website demonstrates a solid security baseline appropriate for its business context. The domain registration data aligns well with the company's claims, showing consistency and legitimacy. No WAF or blocking mechanisms interfere with content accessibility, allowing full analysis. Strategic recommendations include enhancing security headers, publishing incident response and vulnerability disclosure policies, and improving accessibility features to further strengthen trust and compliance.

30
40
-
85
-
75
100
infrastructuretechnologysustainabilityinvestorrelationsenergy+1 more
jQueryWebflowGoogle AnalyticsCookieConsent2
2025-06-18T08:56:09.645Z
toyota-forklifts.co.uk favicon

Toyota Material Handling UK

toyota-forklifts.co.uk

58
TransportationUnited KingdomlargeMEDIUM

Toyota Material Handling UK is a leading provider of forklift trucks and material handling equipment, offering a comprehensive range of products including hand pallet trucks, powered pallet trucks, stackers, order pickers, reach trucks, and counterbalance forklifts with various energy solutions. The company holds a strong market position as the global number one in material handling since 2001, supported by a national service network and a broad portfolio of services such as rental, used trucks, service packages, parts, operator training, and fleet management solutions. Their website reflects a mature digital presence with professional design, clear navigation, and mobile optimization. Technically, the website employs modern web technologies including jQuery, Bootstrap, React components, and integrates multiple third-party services such as Google Tag Manager, Cookiebot for consent management, Hubspot for marketing, and Hotjar for analytics. The site is hosted on secure infrastructure with HTTPS enforced and uses CDN services for performance. SEO and accessibility practices are well implemented, supported by structured data and meta tags. From a security perspective, the site demonstrates good practices including HTTPS, CSRF protection on forms, and comprehensive cookie consent mechanisms. No critical vulnerabilities or exposed sensitive data were detected. However, there is no explicit security policy or incident response contact information published, which could be improved to enhance trust and compliance. Overall, the website and business exhibit a high level of professionalism, security, and compliance with privacy regulations such as GDPR. Strategic recommendations include publishing a dedicated security policy, providing incident response contacts, implementing a security.txt file, and continuously auditing third-party scripts to maintain security posture.

50
58
5
93
-
70
100
forkliftmaterialhandlingtoyotalogisticsrental+5 more
jQueryBootstrap 3.3.1Google Tag ManagerCookiebot+5

Partner Domains:

hubspot.com
partner
cookiebot.com
partner

+3 more partners

2025-06-18T08:56:09.451Z
spk.gov.tr favicon

Sermaye Piyasası Kurulu

spk.gov.tr

40
FinanceTurkeylargeHIGH

Sermaye Piyasası Kurulu (SPK) is the official Capital Markets Board of Turkey, serving as the primary regulatory authority overseeing capital markets, investment firms, and financial instruments within the country. The website provides comprehensive information and services targeted at investors, companies, and financial institutions, including regulatory frameworks, bulletins, licensing exams, and investor education. The site is well-branded, consistent, and professionally maintained, reflecting its authoritative government status. Technically, the website employs modern web technologies such as HTML5, CSS3, JavaScript libraries including Swiper.js for carousels and Tobii.js for lightbox functionality, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized with good navigation and SEO practices, although accessibility features could be enhanced. From a security perspective, the site enforces HTTPS with an excellent SSL configuration and follows best practices like opening external links in new tabs and avoiding exposed sensitive data. However, it lacks explicit security policies, incident response contacts, and a cookie consent mechanism, which are areas for improvement to enhance compliance and user trust. Overall, the website is a credible and authoritative source for capital market regulation in Turkey, with a strong business credibility score and good technical implementation. Strategic recommendations include adding privacy and security policy pages, implementing cookie consent, and enhancing accessibility and security headers to further strengthen the site's security posture and compliance.

-
10
-
60
-
65
100
financegovernmentcapitalmarketsregulationinvestorprotection+1 more
HTML5CSS3JavaScriptSwiper.js (carousel)+3

Partner Domains:

kap.org.tr
partner
tefas.gov.tr
partner

+2 more partners

2025-06-18T08:56:09.439Z
arrito.com favicon

Arrito AB

arrito.com

38
TechnologyN/asmallHIGH

Arrito AB is a small technology service provider specializing in backend systems development and microservice architecture, leveraging technologies such as Spring Boot and Google Cloud Platform. The company targets businesses requiring professional IT development and architecture services, focusing on retail process management and cloud-native solutions. The website presents a professional design with clear navigation and relevant content, though it lacks comprehensive compliance and security disclosures. Technically, the website uses modern frameworks including Bootstrap, JavaScript libraries, and cloud platform references, indicating a moderate level of digital maturity. Performance and mobile optimization are adequate, but SEO and accessibility features are basic. No CMS or hosting provider details are evident. From a security perspective, the site lacks visible security headers, privacy and cookie policies, and incident response information. No HTTPS status is provided in the data, so SSL configuration cannot be confirmed. The absence of vulnerability disclosure and data protection officer contacts suggests limited security maturity. No exposed sensitive data or vulnerable libraries were detected. Overall, the website scores moderately on content quality and business credibility but scores low on privacy compliance and security posture. Strategic improvements in compliance documentation, security headers, and incident response transparency are recommended to enhance trust and reduce risk.

15
10
-
45
-
70
100
itdevelopmentbackendsystemsmicroservicesspringbootgooglecloudplatform+1 more
JavaSpring BootNodejsKubernetes+3
2025-06-18T08:56:09.393Z