Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149091
Websites
130
Industries
113
Countries
52
Avg Score
Page 51 of 53|Showing 2501-2550 of 2607
domaine.fr favicon

Domaine.fr

domaine.fr

55
TechnologyFrancemediumMEDIUM

Domaine.fr is a well-established French domain registrar and web hosting provider operating since 1996. The company offers a broad range of domain extensions and hosting solutions including shared hosting and VPS, complemented by SSL certificate acquisition and expert customer support. Their market position is solid within the French and international domain registration sector, targeting businesses and individuals seeking reliable domain and hosting services. The website is professionally designed, mobile-optimized, and provides clear navigation and comprehensive domain search capabilities. Technically, Domaine.fr employs modern web technologies such as Bootstrap, jQuery, and integrates Google Analytics and Facebook SDK for marketing and analytics purposes. The site uses HTTPS with strong SSL configuration and includes CSRF protection in forms, indicating a good security baseline. However, there is room for improvement in security headers and publishing explicit security policies or incident response information. From a security perspective, the site shows no signs of vulnerabilities or exposed sensitive data. Privacy compliance is basic with cookie consent banners and privacy policies present, but GDPR compliance could be enhanced with more detailed disclosures. Contact information is transparent and includes multiple channels, supporting business credibility and user trust. Overall, Domaine.fr presents a trustworthy and professional online presence with a strong business foundation and good technical implementation. Strategic enhancements in security policy transparency and privacy compliance would further strengthen their posture and user confidence.

65
25
17
75
67
65
40
domainregistrationwebhostingsslcertificatesfrenchregistrardomainsearch+1 more
Bootstrap 4.5.2jQuery 3.5.1Font Awesome 4.7.0AOS (Animate On Scroll)+3
2025-06-22T22:38:59.859Z
charlestowncentre.ie favicon

Charlestown Shopping Centre

charlestowncentre.ie

27
RetailIrelandmediumHIGH

Charlestown Shopping Centre is a retail shopping centre located in North Dublin, Ireland, offering a variety of retail stores, dining options, and leisure facilities. The website targets local shoppers and visitors seeking a convenient and contemporary shopping experience. The business model focuses on providing retail space and services to well-known brands, positioning itself as a key shopping destination in the region. The website content is basic, with moderate branding consistency and some trust indicators such as social media presence and known retail brands. Technically, the website uses a combination of older and modern web technologies including jQuery 1.10.2, Foundation CSS framework, Google Analytics, and Facebook SDK. The site shows moderate performance and basic mobile optimization but lacks advanced accessibility and SEO features. There is no detected CMS or hosting provider information. The site does not appear to be blocked or protected by a WAF. From a security perspective, the website lacks visible security headers and uses an outdated version of jQuery which may expose it to vulnerabilities. There is no evidence of HTTPS enforcement or SSL configuration details in the provided data. Privacy and cookie policies are absent, indicating poor privacy compliance. No incident response or security policy information is available. The domain uses privacy protection for WHOIS data, which is common and acceptable for this business type, with no suspicious patterns detected. Overall, the website scores moderately in business credibility but poorly in privacy compliance and security posture. Strategic improvements in updating libraries, implementing security headers, adding privacy and cookie policies, and ensuring HTTPS enforcement are recommended to enhance trust and security.

15
-
-
70
-
75
-
shoppingretailleisurediningfashion+3 more
jQuery 1.10.2Google AnalyticsFacebook SDKFoundation CSS framework+1
2025-06-22T09:00:04.478Z
P

Photocity.it srl

photocity.it

46
E-commerceItalymediumHIGH

Photocity.it srl operates a professional and comprehensive e-commerce platform specializing in photo printing and personalized photo products such as photobooks, calendars, canvas prints, and gadgets. The website targets consumers in Italy seeking quality photo printing services with a strong emphasis on customer satisfaction, as evidenced by extensive positive reviews and trust signals. The company maintains a consistent brand presence and offers a broad product range, positioning itself as a leading player in the Italian online photo printing market. Technically, the site employs a mature technology stack including Bootstrap 3 and jQuery 1.12, integrated with multiple analytics and advertising platforms such as Google Analytics, Microsoft Clarity, Facebook Pixel, and Bing UET, all managed with user consent mechanisms to comply with GDPR. Security posture is generally good with HTTPS enforced and consent-based loading of tracking scripts, though improvements can be made by adding security headers and updating legacy libraries. Overall, the site is well-structured, mobile-optimized, and professionally maintained, with no signs of blocking or WAF interference, indicating a trustworthy and reliable online presence.

15
43
5
70
-
70
100
photoprintinge-commercepersonalizedgiftsphotobookscalendars+3 more
jQuery 1.12Bootstrap 3Google Tag ManagerMicrosoft Clarity+4

Partner Domains:

boopen.it
partner
partypix.it
partner

+2 more partners

2025-06-21T18:22:03.137Z
spca.com favicon

SPCA de Montréal

spca.com

38
Non-profitCanadamediumHIGH

SPCA de Montréal is a well-established non-profit organization dedicated to animal welfare since 1869. The website serves as a comprehensive platform for adoption services, reporting animal abuse, sterilization clinics, and community support programs. It targets a broad audience including potential adopters, donors, volunteers, and the general public interested in animal protection in the Montreal region. The organization maintains a strong market position as a leading animal welfare entity in Quebec, supported by partnerships with recognized brands and active social media engagement. Technically, the website is built on WordPress with Elementor, leveraging modern JavaScript libraries and third-party integrations such as Google reCAPTCHA and Donorbox for donations. The site demonstrates good mobile optimization, SEO practices, and moderate performance. Hosting is provided by Selectrum Communications, and the site uses HTTPS with a good SSL configuration. From a security perspective, the site employs HTTPS, reCAPTCHA, and cookie consent mechanisms, but lacks explicit advanced security headers and a published security.txt or incident response policy. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with a clear privacy policy and cookie consent. Overall, the website is professional, trustworthy, and well-maintained, with a high legitimacy score based on domain age and WHOIS data. Strategic recommendations include enhancing security headers, publishing incident response information, and improving accessibility features to further strengthen the security posture and compliance.

20
25
5
70
-
75
20
non-profitanimalwelfaredonationadoptioncharity+4 more
WordPressElementorjQueryGoogle reCAPTCHA+6

Partner Domains:

purina.ca
partner
mondou.com
partner

+3 more partners

2025-06-21T18:22:02.380Z
M

Malta Red Cross

redcross.org.mt

43
Non-profitMaltamediumHIGH

Malta Red Cross is a well-established non-profit organization dedicated to humanitarian aid, first aid training, and emergency operational services within Malta. The website provides comprehensive information about their services, volunteering opportunities, donation options, and educational courses. It targets the general public, volunteers, and donors, positioning itself as a trusted national Red Cross society with strong brand recognition and social media presence. Technically, the website is built on ASP.NET Web Forms with common libraries such as jQuery and Bootstrap, integrating Google Analytics and Facebook SDK for tracking and social engagement. The site is moderately optimized for mobile devices and offers a good user experience with clear navigation and professional design. However, SEO and accessibility features are basic and could be enhanced. From a security perspective, the site uses HTTPS and avoids exposing sensitive data but lacks important security headers and formal privacy or cookie policies, which are critical for GDPR compliance. No incident response or vulnerability disclosure mechanisms are evident. The WHOIS data aligns well with the website's claims, supporting its legitimacy. Overall, the site scores well on business credibility but has room for improvement in privacy compliance and security best practices.

15
-
-
70
-
85
100
non-profithumanitarianfirstaidvolunteeringdonation+2 more
jQuery 1.11.0BootstrapFont Awesome 4.1.0Google Analytics+1

Partner Domains:

www.icrc.org
partner
www.ifrc.org
partner

+1 more partners

2025-06-21T18:21:59.451Z
chic.com.mt favicon

CHIC Med-Aesthetic Clinics

chic.com.mt

52
HealthcareMaltamediumMEDIUM

CHIC Med-Aesthetic Clinics is a professional healthcare provider specializing in med-aesthetic and primary care treatments, operating from a state-of-the-art medical facility located near Malta International Airport. The company holds a strong market position in Malta, offering a comprehensive range of medical and aesthetic services including laser hair removal, Botox injections, and primary care medical services. The website reflects a medium-sized business with a clear focus on client convenience and advanced technology. Technically, the website is built on WordPress using Elementor and integrates modern SEO and analytics tools such as Yoast SEO and Google Analytics. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. Security measures include HTTPS enforcement and Google reCAPTCHA v3 on forms, with GDPR-compliant cookie consent mechanisms in place. The security posture is solid with no critical vulnerabilities detected in the HTML content. However, some security headers are not explicitly confirmed and could be improved. Privacy compliance is well addressed with clear privacy and cookie policies. Contact information is prominently displayed, enhancing business credibility. Overall, the website presents a trustworthy and professional digital presence for CHIC Med-Aesthetic Clinics, with recommendations to enhance security headers and publish formal security policies to further strengthen trust and compliance.

15
55
-
85
-
75
100
healthcaremed-aestheticmedicalservicesmaltawordpress+2 more
WordPressElementorYoast SEOGoogle Analytics+3
2025-06-21T18:21:59.042Z
wilhelmsen.com favicon

Wilhelmsen

wilhelmsen.com

44
TransportationN/aenterpriseHIGH

Wilhelmsen is an established enterprise-level maritime services company focused on shaping the global maritime industry through innovation, expertise, and quality products and services. Their offerings include port services, ship services, ship management, new energy solutions, and other related maritime services. The company targets maritime industry stakeholders and global fleet operators, positioning itself as a diversified and trusted service provider in the transportation sector. Technically, the website employs a modern technology stack including React, jQuery, Microsoft Application Insights, Google Tag Manager, and Cookiebot for consent management. The site is hosted likely on Microsoft Azure and uses EpiServer CMS. Performance and mobile optimization are good, with basic accessibility features and solid SEO implementation. From a security perspective, the site enforces HTTPS, uses monitoring tools, and implements cookie consent mechanisms. However, explicit security headers are missing, and no vulnerability disclosure or security.txt files are found. Incident response contact channels exist but lack direct email addresses. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website is professional, trustworthy, and compliant with privacy regulations. The risk level is moderate with recommendations to enhance security headers, publish vulnerability disclosure policies, and improve accessibility compliance.

45
63
-
80
-
85
-
maritimeshippingportservicesshipmanagementnewenergy+2 more
ReactjQueryTypekitMicrosoft Application Insights+4
2025-06-21T18:21:58.817Z
nectar.com.mt favicon

Nectar Limited

nectar.com.mt

45
RetailMaltamediumHIGH

Nectar Limited is a Malta-based company specializing in the importation and distribution of food and beverage products across Malta and Gozo. Established in 1991, the company positions itself as a leading distributor in the local market, offering services in logistics, sales, and marketing. The website reflects a professional and consistent brand image, targeting businesses and consumers within the Maltese islands. The digital presence is supported by modern web technologies including WordPress, Bootstrap, and integration with social media platforms such as Facebook and YouTube. SEO practices are implemented via Yoast SEO, enhancing visibility and user engagement. From a technical perspective, the website employs a mature technology stack with responsive design and moderate performance. Security measures include HTTPS enforcement and Google reCAPTCHA v3 on the contact form, mitigating spam and ensuring secure data submission. However, the absence of key security headers and a cookie consent mechanism indicates room for improvement in compliance and security hardening. No direct company emails or phone numbers are published, with contact facilitated solely through a web form. The security posture is moderate, with no critical vulnerabilities detected but lacking comprehensive policies or incident response information. Privacy compliance is basic, with a privacy policy present but no explicit cookie consent or GDPR compliance indicators. The domain registration data is consistent with the business claims, supporting the legitimacy of the website and company. Overall, the website demonstrates a solid foundation with opportunities to enhance security, privacy, and user trust through additional transparency and technical controls. Strategic recommendations include implementing security headers, adding a cookie consent banner, publishing security and incident response policies, and providing direct contact information to improve trust and compliance. These steps will strengthen the company's digital maturity and align with best practices in security and privacy.

25
3
-
70
-
80
100
fooddistributionbeveragedistributionmaltalogisticssales+2 more
WordPressBootstrap 5Slick CarouseljQuery+2

Partner Domains:

stevesandco.com
partner
2025-06-21T18:21:58.609Z
pg-global.com favicon

PG Global

pg-global.com

56
EnergyUnited KingdommediumMEDIUM

PG Global is an established international specialist recruitment company focused on the energy, oil & gas, renewable energy, and marine sectors. With over 20 years of experience, it serves a global clientele by connecting professionals with relevant job opportunities and providing comprehensive recruitment and consultancy services. The company positions itself as a leading player in its niche with a strong emphasis on quality and client satisfaction. Technically, the website is built on WordPress, leveraging modern SEO tools like Yoast SEO and performance optimizations such as WP Rocket. It integrates multiple social media platforms and analytics services, indicating a mature digital presence. The site is mobile-optimized and provides multilingual support, enhancing accessibility for international users. From a security perspective, the site uses HTTPS and avoids exposing sensitive data. However, it lacks some security headers and formal security policies, which could be improved. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. The domain registration details are consistent with the business claims, supporting legitimacy. Overall, PG Global's website reflects a professional and credible business with room for improvement in privacy compliance and security best practices. Strategic enhancements in these areas would strengthen trust and regulatory adherence.

65
28
-
85
-
85
100
recruitmentenergyoilandgasmarinerenewableenergy+2 more
jQueryYoast SEOWP RocketGoogle Analytics+5
2025-06-21T18:21:56.151Z
vivendo.com.mt favicon

Vivendo

vivendo.com.mt

49
HospitalityMaltamediumHIGH

Vivendo is a Malta-based group specializing in end-to-end provision of technical services, finishing, and furnishing primarily for the hospitality, office, and wellness sectors. The company holds a strong market position as a leading furniture supplier in Malta, with exclusive distribution partnerships with notable brands such as Poltronesofà and Vitra. Their business model focuses on B2B services, targeting hotels, offices, and fitness centers, offering tailored furnishing solutions and project management expertise. Technically, the website is built on a modern WordPress CMS platform with WooCommerce integration for product catalog and quote requests. It employs a variety of contemporary web technologies including Google Analytics, Facebook SDK, Vimeo embeds, and several JavaScript libraries for enhanced user experience and interactivity. The site demonstrates good mobile optimization, SEO practices, and accessibility features, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms compliant with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, there is room for improvement in implementing additional security headers and publishing explicit security policies. The WHOIS data aligns well with the website's business claims, indicating legitimacy and consistency. Overall, Vivendo presents a professional, trustworthy, and well-structured online presence with strong compliance and security postures. Strategic recommendations include enhancing security headers, formalizing incident response policies, and continuous auditing of third-party scripts to maintain security and compliance standards.

-
75
-
50
-
85
100
wordpresswoocommercehospitalityfurnituremalta+3 more
WordPressWooCommerceGoogle AnalyticsFacebook SDK+8

Partner Domains:

www.poltronesofa.com
partner
www.vitra.com
partner
2025-06-21T18:21:55.773Z
V

Vincent Curmi & Associates

vca.com.mt

43
FinanceMaltasmallHIGH

Vincent Curmi & Associates (VCA) is a boutique accounting and consulting firm based in Malta with over 45 years of experience. The company offers a range of services including audit and assurance, corporate services, back office support, and tax compliance. Their business model focuses on personalized client relationships and tailored service delivery, targeting businesses and individuals operating in or with interests in Malta. The website reflects a professional and consistent brand presence with clear navigation and relevant content for their audience. Technically, the website is built on ASP.NET WebForms with legacy JavaScript libraries such as jQuery 1.7.1 and Modernizr 2.0.6. It integrates social media SDKs and Google Analytics for marketing and tracking purposes. The site shows moderate performance and basic mobile optimization but lacks modern security headers and HTTPS enforcement, which are critical for protecting user data and maintaining trust. From a security perspective, the absence of HTTPS and use of outdated libraries present significant vulnerabilities. No explicit security policies, incident response contacts, or data protection officer information are published, indicating gaps in compliance and security maturity. The website does provide clear contact information and links to reputable Maltese regulatory bodies, supporting its legitimacy. Overall, while the business credibility and content quality are good, the technical and security posture require urgent improvements to meet modern standards and regulatory compliance. Strategic enhancements in SSL implementation, library updates, and privacy mechanisms are recommended to reduce risk and enhance user trust.

15
3
5
70
-
80
100
accountingaudittaxcorporateservicesmalta+2 more
jQuery 1.7.1Modernizr 2.0.6ASP.NET WebFormsFacebook SDK+1
2025-06-21T18:21:55.246Z
kidstart.co.uk favicon

KidStart Limited

kidstart.co.uk

54
FinanceUnited KingdommediumMEDIUM

KidStart Limited operates a UK-based cashback platform designed to help families save money for their children by earning cashback on everyday online purchases from a wide range of partner retailers. The website is well-branded and targets parents, grandparents, and family members interested in building savings for children. The business model leverages affiliate partnerships with major retailers and financial services, including a Junior ISA offering. The site demonstrates a solid market position with visible trust indicators such as FCA authorization and customer testimonials. Technically, the website uses a traditional tech stack including jQuery, Font Awesome, Facebook SDK, and Google Analytics. While the site is mobile-optimized and has good SEO practices, some technical debt is evident with the use of an older jQuery version and lack of modern security headers. Performance is moderate, and accessibility is basic but functional. From a security perspective, the site enforces HTTPS and integrates secure Facebook OAuth login flows. However, it lacks explicit security headers and uses an outdated JavaScript library version, which could expose it to vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR indicators. No direct contact emails or phone numbers are provided on the main pages, which may affect user trust slightly. Overall, KidStart presents a trustworthy and professional online presence with a good balance of business credibility and privacy compliance. Security posture is adequate but could be improved by updating libraries and adding security headers. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements in security and contact transparency would enhance trust and resilience.

55
43
-
85
-
70
100
cashbackchildrensavingsfamilyfinanceshoppinguk+2 more
jQuery 1.10.1Font AwesomeFacebook SDKGoogle Analytics+2

Partner Domains:

beanstalkapp.co.uk
partner
smart.link
partner
2025-06-21T18:21:54.663Z
d-a-z.hr favicon

Društvo Arhitekata Zagreba

d-a-z.hr

40
OtherCroatiasmallHIGH

Društvo Arhitekata Zagreba (DAZ) is a professional association dedicated to architects in Zagreb, Croatia. The website serves as a hub for architectural news, events, competitions, member profiles, and educational programs. It targets architecture professionals, students, and enthusiasts within the region, providing a platform for community engagement and professional development. The organization appears well-established with a clear focus on promoting architectural culture and activities in Zagreb. Technically, the website employs a mix of older and modern technologies including jQuery 1.7, UIkit framework, Font Awesome icons, and integrates external services such as Google Tag Manager and Facebook SDK for analytics and social media functionalities. The site is mobile-optimized and offers a structured navigation experience, although some technical aspects like outdated libraries and missing security headers could be improved. From a security perspective, the site uses HTTPS and includes some best practices like asynchronous loading of external scripts. However, it lacks explicit security headers, vulnerability disclosure policies, and incident response information. The absence of privacy and cookie policies, as well as consent mechanisms, indicates gaps in compliance with GDPR and related privacy regulations. Overall, the website is functional, professional, and credible for its intended audience but would benefit from enhanced security measures and privacy compliance to strengthen trust and regulatory adherence.

15
10
25
70
47
80
-
arhitekturadazizlobanatjeajpredavanje+3 more
jQuery 1.7Google Tag ManagerFacebook SDKUIkit 2.27.5+2

Partner Domains:

uha.hr
partner
arhibau.d-a-z.hr
partner

+3 more partners

2025-06-21T14:02:52.517Z
ldz.lv favicon

VAS Latvijas dzelzceļš

ldz.lv

58
TransportationLatvialargeMEDIUM

VAS Latvijas dzelzceļš is the national railway company of Latvia, operating as a large state-owned enterprise focused on rail freight and passenger transport, infrastructure management, and related services including energy sales and logistics. The company maintains a strong market position as the primary rail operator in Latvia, serving both business and private customers. Their digital presence is supported by a Drupal 7 CMS platform with modern frontend technologies such as Bootstrap and jQuery, and includes integration with major social media platforms and analytics tools. The website demonstrates a mature technical infrastructure with good mobile optimization, accessibility, and SEO practices. Security posture is solid with HTTPS enforced and cookie consent mechanisms implemented, although there is room for improvement in security headers and incident response transparency. Privacy compliance is well addressed with comprehensive privacy and cookie policies in Latvian, aligned with GDPR requirements. Overall, the website and business exhibit high trustworthiness and professionalism, supported by certifications such as ISO 50001 and clear contact information. The domain registration details are consistent with the company's identity and history, reinforcing legitimacy. Strategic recommendations include enhancing security headers, publishing incident response contacts, and modernizing the CMS for improved security.

40
25
25
70
52
70
100
transportationrailwayenergylogisticsgovernment+1 more
jQuery 1.9Drupal 7BootstrapFacebook SDK+2

Partner Domains:

ldzcargo.ldz.lv
subsidiary
logistika.ldz.lv
subsidiary

+3 more partners

2025-06-18T16:49:52.059Z