Skip to main content

Real Estate security reports

Browse 3,974 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 40 of 80|Showing 1951-2000 of 3974
asaimnieks.lv favicon

SIA Āgenskalna Namsaimnieks

asaimnieks.lv

54
Real EstateLatviasmallMEDIUM

SIA Āgenskalna Namsaimnieks is a Latvian company specializing in professional property management and maintenance services primarily focused on residential multi-apartment buildings in Riga. The company manages approximately 40 properties and offers services including technical maintenance, renovation planning, and resident representation. The website is well-structured, professionally designed, and targets property owners and managers in the local market. The business model centers on providing comprehensive property management solutions with a local focus. Technically, the website is built using modern web technologies such as Next.js and React, with integration of Google Maps API for property location visualization. The site demonstrates good mobile optimization and SEO practices but lacks some accessibility features. Performance is moderate, with no major issues detected. However, there is no evidence of advanced analytics or tracking tools, indicating a minimal user tracking approach. From a security perspective, the site uses HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and does not provide privacy or cookie policies, which are important for GDPR compliance. There is no visible incident response or vulnerability disclosure information, which could be improved to enhance trust and security posture. The absence of WHOIS data due to query limits limits domain registration analysis, but the website content and contact details appear legitimate and consistent with a small local business. Overall, the website presents a professional and trustworthy front for a local property management company but would benefit from enhanced privacy compliance, security best practices, and transparency measures to improve its security posture and regulatory adherence.

30
10
2
60
72
85
100
propertymanagementrealestatelatviaprofessionalservicesnextjs+1 more
Next.jsReactGoogle Maps API
2025-07-30T16:00:51.659Z
rigabrokers.lv favicon

Riga Brokers SIA

rigabrokers.lv

50
Real EstateLatviasmallMEDIUM

Riga Brokers SIA operates as a Latvian real estate brokerage firm specializing in the sale and rental of residential and commercial properties. The company emphasizes a professional and individualized approach to client needs, positioning itself as a trusted partner in the real estate market. The website is well-structured, multilingual, and targets Latvian-speaking audiences primarily, with English and Russian language options available. The business model revolves around agent-mediated property transactions with commission-based revenue from sellers and landlords. Technically, the website employs modern web technologies including Google Tag Manager, Google Analytics, Facebook Pixel, and cookie consent mechanisms to ensure compliance with privacy regulations. The site is mobile-optimized, accessible, and uses HTTPS with good SSL configuration. However, some security headers are missing, and no explicit security or incident response policies are published. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and cookie consent with opt-in. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data due to query limits restricts full domain trust verification, but the website content and presentation suggest a legitimate and professional operation. Overall, the website scores well in content quality, technical implementation, security posture, privacy compliance, and business credibility. Strategic improvements include adding security headers, publishing security policies, and providing clearer contact information to enhance trust and compliance.

55
25
2
70
72
75
20
realestatepropertybrokerlatviahousing+2 more
Google Tag ManagerGoogle Analytics (gtag.js)Facebook PixelTiny Slider+2
2025-07-30T16:00:50.322Z
latviaeuropeanresidency.com favicon

S-Baltic LV

latviaeuropeanresidency.com

9
Real EstateLatviamediumCRITICAL

S-Baltic LV operates a professional website focused on providing residence and citizenship by investment services, primarily for Latvia and the broader European Union. The company is positioned as a global leader in this niche, founded by an experienced immigration specialist, Mr. Gerald Hoppstaedter. Their services include immigration legal support, visa applications, document legalization, real estate advice, and company establishment. The website reflects a medium-sized business with a clear target audience of international investors and entrepreneurs seeking residency solutions in Europe. Technically, the website is built on WordPress with popular plugins such as WooCommerce and Elementor, indicating a modern and flexible infrastructure. Hosting appears to be managed via GoDaddy, with standard technologies like jQuery and Slider Revolution enhancing user experience. The site is mobile-optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No privacy or cookie policies were found, representing a compliance gap with GDPR and related regulations. Contact information is available primarily via phone and contact forms, but no verified company emails were found. Overall, the website is trustworthy and professional but would benefit from improved privacy compliance and enhanced security measures. The domain registration is consistent with the business claims, and no blocking or WAF challenges were detected, allowing full content access and analysis.

-
-
-
-
-
-
-
immigrationresidencyinvestmentlatvialegalservices+2 more
WordPressWooCommerceElementorjQuery+3

Partner Domains:

www.sbaltic.com
partner
2025-07-30T16:00:48.242Z
C

Cenu Banka

cenubanka.lv

59
Real EstateLatviamediumMEDIUM

Cenu Banka is a Latvian company providing a comprehensive real estate transaction database and market analysis platform primarily targeting real estate professionals and private individuals in Latvia. The platform offers access to registered property transactions, listings, and user comments, supporting informed decision-making in the real estate market. Established since 2010, it serves over 150 companies and institutions, positioning itself as a leading data provider in the Latvian real estate sector. Technically, the website employs modern tracking and analytics tools such as Google Tag Manager and Facebook Pixel, uses HTTPS with CSRF protection on forms, and demonstrates good mobile optimization and SEO practices. Security posture is solid with encrypted connections and basic security best practices, though it lacks explicit security policies and advanced security headers. Privacy and cookie policies are present and indicate GDPR compliance. The absence of WHOIS data due to query limits limits full domain legitimacy verification, but the professional presentation, clear contact information, and client testimonials support a trustworthy business profile. Overall, the site is well-structured, content-rich, and professionally maintained, with moderate technical sophistication and a good security baseline.

30
43
2
70
75
75
100
realestatepropertydatamarketanalysislatviapropertytransactions+1 more
jQueryGoogle Tag ManagerFacebook PixelCookie Script
2025-07-30T16:00:48.189Z
hepsor.lv favicon

Hepsor

hepsor.lv

44
Real EstateLatviamediumHIGH

Hepsor is a reputable real estate development company operating primarily in Latvia and Estonia, focusing on delivering quality residential and commercial properties with an emphasis on green and thoughtful design. The company is positioned as one of the leading developers in the Baltic region, targeting investors, home buyers, and commercial tenants. Their website showcases a variety of ongoing and completed projects, reflecting a mature business model centered on property development and leasing. Technically, the website is built on WordPress with modern enhancements such as lazy loading, asynchronous script loading, and integration with major analytics and advertising platforms like Google Analytics, Google Ads, and Facebook Pixel. The site is mobile-optimized and SEO-friendly, though some accessibility features could be improved. Security practices include HTTPS enforcement and use of Google reCAPTCHA, but lack of security headers and visible security policies indicate room for improvement. From a security perspective, the site demonstrates a solid baseline with encrypted communications and anti-bot measures. However, the absence of published security policies, incident response contacts, and vulnerability disclosure mechanisms suggests a moderate security maturity level. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with cookie consent implemented but no clear privacy or terms of service pages found. Overall, the website and business present a trustworthy and professional image with good technical implementation and business credibility. Strategic enhancements in privacy transparency, security headers, and incident response documentation would further strengthen their security posture and compliance standing.

15
10
2
70
72
80
20
realestatepropertydevelopmentresidentialcommercialinvestment+3 more
WordPressjQueryGoogle Tag ManagerGoogle Analytics+4

Partner Domains:

hepsor.ee
sister
dzresidence.lv
partner

+1 more partners

2025-07-30T16:00:47.809Z
montaz.lv favicon

Montaz.lv™

montaz.lv

43
Real EstateLatviasmallHIGH

Montaz.lv is a Latvian-based small business specializing in the installation and maintenance of windows, doors, loggias, and aluminum structures. The website presents a professional and consistent brand image with clear service offerings targeted at residential and commercial property owners in Latvia. The business model focuses on providing specialized installation and measurement services, glass package replacement, and warranty servicing. The site is multilingual, supporting Latvian, Russian, and English languages, enhancing accessibility for a broader audience. Technically, the website is built on WordPress 6.8.2 with common web technologies such as jQuery, Bootstrap, and Slick Slider. The site demonstrates moderate performance and good mobile optimization, though accessibility features are basic. The use of HTTPS ensures secure communication, and form inputs include validation, but security headers are missing, which could be improved. From a security perspective, the site lacks explicit privacy, cookie, and terms of service policies, which impacts GDPR compliance and user trust. No incident response or vulnerability disclosure information is provided. The absence of WHOIS data due to query limits restricts domain legitimacy verification, though the website content appears legitimate and consistent with a small local business. Facebook SDK is used for social integration and tracking, indicating some level of user data collection. Overall, Montaz.lv presents a functional and professional online presence for its niche market but would benefit from enhanced privacy compliance, security best practices, and transparency to improve trust and regulatory adherence.

15
10
2
85
62
80
20
windowsdoorsinstallationmaintenancealuminumstructures+2 more
WordPress 6.8.2PHPjQuery 3.7.1Bootstrap 4.18.1+3
2025-07-30T16:00:47.428Z