Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 86 of 251|Showing 4251-4300 of 12548
forpsi.cz favicon

FORPSI

forpsi.cz

73
TechnologyCzech RepublicmediumMEDIUM

FORPSI is a Czech-based technology company specializing in domain registration, web hosting, VPS, and cloud services. The company positions itself as a professional and reliable partner with its own data center, targeting both business and individual customers seeking affordable and comprehensive hosting solutions. The website content is well-structured and presented in Czech, reflecting a focus on the local market. The business model revolves around providing essential internet infrastructure services with a strong emphasis on domain and hosting offerings. Technically, the website employs a modern technology stack including jQuery, select2, Google Tag Manager, Cookiebot for consent management, and analytics tools such as Google Analytics, CrazyEgg, and Smartlook. The site is built on Kentico CMS, indicating a mature content management infrastructure. Performance and mobile optimization are good, with proper SEO and accessibility features, although some accessibility aspects could be improved. From a security perspective, the site enforces HTTPS and uses cookie consent mechanisms aligned with GDPR requirements. However, it lacks visible security headers and published security policies or incident response information, which are areas for improvement. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of WHOIS registrant data reduces trust slightly but does not negate the professional appearance and functionality of the site. Overall, FORPSI presents a solid digital presence with good privacy compliance and technical implementation. Strategic recommendations include enhancing transparency by publishing security and incident response policies, improving contact information visibility, and adding security headers to strengthen the security posture further.

35
88
30
82
90
85
100
webhostingdomainregistrationvpscloudservicesczechrepublic+3 more
jQuery 3.7.1select2Google Tag ManagerCookiebot+6
2025-10-12T18:54:25.097Z
memberstack.com favicon

Memberstack

memberstack.com

68
TechnologyN/amediumMEDIUM

Memberstack is a SaaS platform specializing in providing membership and subscription management solutions integrated seamlessly with Webflow. The company targets web developers, agencies, and SaaS builders who want to add user accounts, gated content, and subscription features without complex tech stack changes. With over 50,000 teams and agencies using their platform, and trusted by notable brands such as Amazon and Salesforce, Memberstack holds a strong market position in the web development technology sector. The website content is professional, well-structured, and rich with customer testimonials and case studies, reflecting a mature and credible business. Technically, the website leverages modern web technologies including Webflow CMS, React, Node.js for backend APIs, and integrates multiple analytics and marketing tools such as Google Analytics, Microsoft Clarity, PostHog, and Facebook Pixel. Hosting is provided by Webflow, ensuring fast performance and excellent mobile optimization. Accessibility and SEO practices are well implemented, contributing to a positive user experience. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes standard security headers. No vulnerabilities or exposed sensitive data were detected. However, the absence of an explicit cookie consent mechanism and a dedicated security policy page indicates room for improvement in privacy compliance and security transparency. The WHOIS data is unavailable, which reduces transparency but is likely due to privacy protection services common in SaaS businesses. Overall, Memberstack presents a low-risk profile with strong business credibility and technical maturity. Strategic recommendations include implementing explicit cookie consent, publishing a security policy and incident response information, and adding a vulnerability disclosure channel to enhance trust and compliance.

30
80
55
55
62
80
100
membershipwebflowsaassubscriptionsuseraccounts+3 more
Webflow CMSGoogle Tag ManagerFacebook PixelPostHog analytics+6

Partner Domains:

stripe.partners
partner
webflow.com
partner

+1 more partners

2025-10-12T18:54:05.057Z
promptemr.com favicon

Prompt

promptemr.com

69
HealthcareN/amediumMEDIUM

Prompt is a technology company specializing in software solutions for physical and rehab therapy practices. Their platform offers a comprehensive suite of services including EMR, patient management, billing, clinician efficiency, and AI-powered automation to streamline operations and improve patient and staff satisfaction. The company targets healthcare providers in the physical therapy sector, positioning itself as a niche SaaS provider focused on practice growth and operational excellence. The website demonstrates a professional and consistent brand presence with good content quality and user experience. Technically, the website is built on Webflow CMS and integrates multiple modern marketing and analytics tools such as HubSpot, Google Analytics, Facebook Pixel, and LinkedIn Insight Tag. The site is hosted on Webflow's infrastructure, uses HTTPS with good SSL configuration, and implements standard security headers. Performance and mobile optimization are good, though accessibility features are basic. The site employs various tracking and advertising technologies, indicating a mature digital marketing strategy. From a security perspective, the site shows a solid posture with HTTPS enforcement and security headers. However, there is no publicly available security policy, incident response information, or vulnerability disclosure program, which are recommended for enhanced trust and compliance. The absence of WHOIS data for the domain is a notable concern, suggesting the need for further verification of domain registration status. No sensitive data exposure or vulnerabilities were detected in the analyzed content. Overall, Prompt's website is professional, secure, and well-optimized for its target audience. Strategic recommendations include publishing detailed security and incident response policies, verifying domain registration details, and enhancing accessibility compliance to further strengthen trust and compliance.

60
73
22
75
62
85
100
healthcarephysicaltherapyemrpracticemanagementsaas+1 more
WebflowGoogle Tag ManagerFacebook PixelLinkedIn Insight Tag+7
2025-10-12T17:52:35.647Z
stufstorage.com favicon

Stuuf Inc.

stufstorage.com

64
Real EstateUnited StatesmediumMEDIUM

Stuf Storage is a technology-driven self-storage company that offers convenient, secure, and neighborhood-focused storage solutions by repurposing underutilized urban spaces. Their business model emphasizes ease of use with digital key access, month-to-month leases, and online booking, targeting residential customers and small businesses. The company positions itself as an innovative alternative to traditional self-storage providers, supported by strong branding and media presence. Technically, the website is built on modern frameworks such as Next.js and React, integrating multiple third-party analytics and marketing tools including Google Tag Manager, Facebook Pixel, and HubSpot. The site is well-optimized for performance, mobile responsiveness, and SEO, providing a seamless user experience. From a security perspective, the site enforces HTTPS, employs standard security headers, and avoids exposing sensitive data. However, it lacks visible cookie consent mechanisms and published security policies, which are areas for improvement. The absence of WHOIS registration data raises concerns about domain legitimacy, though the professional website content mitigates some risk. Overall, the website demonstrates a mature digital presence with strong business credibility but would benefit from enhanced privacy compliance and transparency regarding domain registration. Strategic recommendations include implementing cookie consent, publishing security and incident response policies, and verifying domain registration details.

20
53
17
75
77
85
100
self-storagestorageunitsdigitalkeytech-enabledstoragemonth-to-monthleases+1 more
ReactNext.jsGoogle Maps APIGoogle Tag Manager+6

Partner Domains:

lp.stufstorage.com
partner
blog.stufstorage.com
partner
2025-10-12T17:51:58.542Z
berryfertility.com favicon

Berry Fertility

berryfertility.com

70
HealthcareN/asmallMEDIUM

Berry Fertility is a healthcare-focused digital platform offering a fertility tracking application designed to assist patients undergoing treatments such as IVF, IUI, FET, and egg freezing. The platform provides comprehensive management tools including medication tracking, appointment scheduling, symptom logging, lab result management, and menstrual cycle monitoring. The website positions itself as a niche player in the fertility healthcare technology market, targeting patients seeking organized and integrated fertility care management. Technically, the website is built using the Framer platform and incorporates modern web technologies including Google Analytics, Facebook Pixel, and PostHog for analytics and tracking. The site demonstrates good design quality and mobile optimization but lacks advanced accessibility features and comprehensive SEO optimization. From a security perspective, the site lacks visible security headers and explicit security policies, and no privacy or cookie policies were detected, indicating gaps in privacy compliance. The WHOIS data is missing, raising concerns about domain legitimacy and trustworthiness. Overall, the website is functional and professionally presented but requires improvements in security posture, privacy compliance, and business transparency to enhance trust and credibility.

95
68
17
75
72
80
100
fertilityhealthcaretrackingivfiui+3 more
Google AnalyticsFacebook PixelPostHogFramer (CMS/website builder)+1
2025-10-12T17:51:31.903Z
fireflies.ai favicon

Digital Privacy Corporation

fireflies.ai

73
TechnologyUnited StatesmediumMEDIUM

Fireflies.ai is a technology company specializing in AI-powered meeting transcription, summarization, and conversation intelligence. Founded in 2017 and operated by Digital Privacy Corporation in the United States, it offers a SaaS platform that integrates with popular meeting and productivity tools to enhance team collaboration and productivity. The company positions itself as an industry leader with a strong market presence, serving over 500,000 companies globally. Their key services include high-accuracy transcription, multi-language support, speaker recognition, AI summaries, and integrations with CRM, project management, and communication platforms. Technically, the website is built on modern frameworks such as Next.js and leverages Cloudflare for DNS and CDN services. It employs multiple analytics and marketing tools including Heap Analytics, Google Tag Manager, Facebook Pixel, and ProfitWell, indicating a mature digital marketing and data collection strategy. The site is well-optimized for performance, mobile responsiveness, and SEO, providing an excellent user experience. From a security perspective, the site uses HTTPS with a clientTransferProhibited domain status, indicating domain transfer protection. It holds GDPR and SOC2 certifications, signaling compliance with key data protection standards. However, DNSSEC is not enabled, and no explicit security.txt or vulnerability disclosure pages were found. No direct contact emails or phone numbers are publicly listed, which may impact user trust and support accessibility. Overall, Fireflies.ai presents a professional, secure, and compliant online presence with strong business credibility and technical maturity. Strategic recommendations include enabling DNSSEC, publishing a security policy or vulnerability disclosure, and providing clearer contact information to enhance trust and compliance further.

50
65
47
80
75
80
100
aimeetingtranscriptionproductivitysaastechnology+1 more
React (Next.js)Cloudflare DNSHeap AnalyticsGoogle Tag Manager+6
2025-10-12T17:49:36.562Z
pillar.io favicon

Domains By Proxy, LLC

pillar.io

58
TechnologyUnited StatesmediumMEDIUM

Pillar.io is a SaaS platform focused on empowering social media creators, coaches, and digital marketers by providing an all-in-one link in bio tool that enables users to create, host, and sell digital products and services. The platform integrates marketing tools, AI assistants, and e-commerce capabilities to automate creator business operations and facilitate brand deals. With a user base exceeding 100,000 creators, Pillar positions itself as a comprehensive solution in the creator economy space. Technically, the website leverages modern web technologies including Webflow CMS, Google Tag Manager, TikTok and Facebook Pixels, PostHog analytics, and personalization tools like Intellimize. Hosting appears to be on AWS infrastructure with GoDaddy as the domain registrar. The site is mobile optimized and demonstrates good SEO and accessibility practices, though some accessibility features are basic. From a security perspective, the website enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, DNSSEC is not enabled, and no explicit security headers or policies are published. The site lacks visible privacy and cookie policies, which impacts privacy compliance scores. No vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, Pillar.io presents a professional and functional platform with moderate security and privacy compliance maturity. Strategic improvements in privacy disclosures, security headers, and DNS security would enhance trust and compliance.

30
53
2
55
67
80
100
creatortoolslinkinbioe-commercemarketingsaas+3 more
Webflow CMSGoogle Tag ManagerTikTok PixelFacebook Pixel+3
2025-10-12T17:48:25.580Z
kinzoo.com favicon

Kinzoo

kinzoo.com

54
TechnologyN/asmallMEDIUM

Kinzoo is a technology company specializing in safe and creative applications for children, focusing on secure communication and interactive content that fosters connection and creativity without exposure to ads or strangers. The company offers three main products: Kinzoo Messenger, Kinzoo Together, and Kinzoo Studio, each designed to provide a child-friendly digital experience. The website is well-designed, mobile-optimized, and features multiple positive testimonials and certifications from recognized child safety organizations, positioning Kinzoo as a trusted niche player in child-safe technology apps. Technically, the website leverages modern web technologies including Webflow CMS, Google Analytics, Google Tag Manager, Facebook Pixel, and Singular SDK for analytics and marketing. It employs HTTPS with strong security headers, cookie consent mechanisms, and multimedia content to engage users effectively. The site demonstrates good performance and accessibility standards. From a security perspective, the site shows good practices such as HTTPS enforcement and security headers, but lacks explicit privacy and terms of service pages, which are important for compliance and user trust. The absence of WHOIS data for the domain raises concerns about domain registration transparency, although the website content and certifications suggest legitimacy. Overall, Kinzoo presents a strong business and technical profile with a focus on child safety and privacy, but should improve transparency by publishing privacy and terms policies and clarifying domain registration details to enhance trust and compliance.

30
83
2
55
-
80
100
child-safekidsappsmessagingvideocallingcreativeapps+3 more
Google AnalyticsGoogle Tag ManagerFacebook PixelSingular SDK+3
2025-10-12T17:48:14.012Z
nutrisense.io favicon

Nutrisense

nutrisense.io

72
HealthcareUnited StatesmediumMEDIUM

Nutrisense is a healthcare-focused company specializing in personalized metabolic health insights through continuous glucose monitoring (CGM) technology combined with expert dietitian coaching. The company targets individuals seeking sustainable health improvements such as weight loss, energy enhancement, and better metabolic control. Their business model is subscription-based, offering CGM sensor deliveries and 1:1 coaching, with some services covered by insurance. The website reflects a mature digital presence with a strong brand, extensive member testimonials, and trust signals like high Trustpilot ratings. Technically, the website leverages modern web technologies including React, Webflow CMS, and AWS Cloudfront for hosting and content delivery. It integrates multiple marketing and analytics tools such as Klaviyo, TikTok Pixel, Facebook Pixel, Microsoft Clarity, and Google Tag Manager, indicating a sophisticated approach to user engagement and data-driven marketing. The site is well-optimized for mobile and accessibility, with fast performance and good SEO practices. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR. While explicit security headers are not fully confirmed in the provided data, the use of reputable third-party services and absence of exposed sensitive data suggest a solid security posture. However, the lack of publicly available incident response or security policy documents is a gap. The WHOIS data is unavailable due to a malformed request, limiting domain trust verification, but the overall site professionalism and branding support legitimacy. Overall, Nutrisense presents a trustworthy and professional online presence with strong business credibility and technical maturity. Strategic recommendations include enhancing public security disclosures, verifying and publishing security headers, and improving WHOIS transparency to bolster domain trust.

60
68
17
85
75
85
100
healthcareglucosemonitoringnutritioncoachingpersonalizedhealth+3 more
React (implied by bundle naming and module usage)Cloudfront CDNKlaviyo (marketing and analytics)TikTok Pixel+8
2025-10-12T17:47:38.870Z
eventbrite.nl favicon

Eventbrite

eventbrite.nl

70
TechnologyNetherlandsenterpriseMEDIUM

Eventbrite is a leading global event technology platform that enables users in the Netherlands and worldwide to discover, create, and manage live events with integrated ticket sales. The platform targets both event organizers and attendees, offering comprehensive tools for event marketing, ticketing, and mobile engagement. Eventbrite holds a strong market position as a trusted and widely used service in the event management industry. Technically, the website leverages modern web technologies including React, Google Analytics, Google Tag Manager, and Branch.io for deep linking and tracking. It employs a robust consent management system (Transcend) to comply with privacy regulations. The site is well-optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital infrastructure. From a security perspective, Eventbrite enforces HTTPS, implements multiple security headers, and uses secure forms with CSRF protection. The presence of comprehensive privacy and cookie policies, along with consent mechanisms, indicates a strong commitment to GDPR compliance. No critical vulnerabilities or suspicious activities were detected, and the WHOIS data aligns with the company's legitimate business operations. Overall, Eventbrite's website demonstrates high professionalism, security maturity, and privacy compliance, making it a trustworthy platform for event-related activities.

30
73
17
100
72
75
100
eventdiscoveryticketingeventmanagementtechnologyonlineplatform+3 more
ReactGoogle AnalyticsGoogle Tag ManagerBranch.io+3

Partner Domains:

eventbritestatus.com
partner
2025-10-12T16:38:23.017Z
betterstack.com favicon

Better Stack

betterstack.com

71
TechnologyN/amediumMEDIUM

Better Stack is a technology company providing an AI-native SaaS platform focused on observability and incident management. Their offerings include monitoring, status pages, tracing, infrastructure monitoring, and log management, targeting developers, SREs, and IT teams. The company positions itself as a modern alternative to legacy tools, emphasizing ease of use and AI-driven insights. The website is professionally designed with excellent content quality and clear navigation, reflecting a mature digital presence. Technically, the site uses modern JavaScript frameworks such as Vue.js and Pinia, with a Ruby on Rails backend inferred from Turbo Rails usage. Hosting and DNS are managed via Cloudflare, ensuring good performance and security. The security posture is strong with HTTPS, CSRF protections, and Sentry integration for error monitoring, though some improvements like enabling DNSSEC and publishing explicit security policies are recommended. Privacy compliance is basic, with a cookie consent mechanism but no visible privacy policy or terms of service pages in the provided content. Contact information is limited to a signup form without direct emails or phone numbers. The domain WHOIS data is consistent and indicates a legitimate, well-established business. Overall, Better Stack demonstrates a high level of professionalism and technical maturity with room for enhanced transparency in privacy and security disclosures.

65
80
14
75
75
75
100
observabilityincidentmanagementmonitoringlogmanagementtracing+4 more
Vue.js 3PiniaStimulusTurbo Rails+9

Partner Domains:

betteruptime.com
subsidiary
logtail.com
subsidiary

+3 more partners

2025-10-12T15:31:33.360Z
revenuecat.com favicon

RevenueCat

revenuecat.com

74
TechnologyN/amediumMEDIUM

RevenueCat is a technology company specializing in providing a SaaS platform that simplifies in-app subscription management, customer data handling, and revenue growth for mobile and web applications. Positioned as a leading provider in this niche, RevenueCat targets app developers and businesses that rely on subscription-based revenue models. Their platform supports iOS, Android, and web environments, offering seamless integration and analytics capabilities. The website reflects a mature digital presence with professional design and clear messaging aligned with their business focus. Technically, the site is built using modern frameworks such as Gatsby and React, and incorporates multiple analytics and marketing tools including Google Analytics, Facebook Pixel, and RudderStack, indicating a sophisticated approach to user tracking and marketing optimization. Security-wise, the website enforces HTTPS and employs standard security headers, but lacks a dedicated security policy or incident response information, which could be improved to enhance trust. The absence of WHOIS data limits transparency about domain registration, but the overall digital footprint and content quality suggest a legitimate and professional business. Strategic recommendations include publishing explicit security and incident response policies and improving domain registration transparency to strengthen trust and compliance.

65
70
17
95
80
80
100
in-apppurchasessubscriptionssaasmobileappsrevenuemanagement+2 more
GatsbyReactGoogle AnalyticsFacebook Pixel+4
2025-10-12T15:31:12.819Z
sgfcitizen.org favicon

Springfield Daily Citizen

sgfcitizen.org

60
MediaUnited StatessmallMEDIUM

Springfield Daily Citizen is a local online newspaper serving the Springfield, Missouri community with community-focused news, event listings, and opinion pieces. Established in 2021, it operates as a small media outlet with a business model centered on digital news delivery supported by advertising and subscriptions. The website is professionally designed using WordPress with the Newspack theme and integrates multiple third-party services for analytics and advertising. The company maintains an active presence on major social media platforms, enhancing its community engagement and reach. Technically, the website leverages a modern CMS infrastructure with SEO optimization and mobile responsiveness. The hosting and domain registration are consistent with a legitimate local business, registered through GoDaddy. Performance is moderate with good mobile optimization, though there is room for improvement in accessibility and security headers. The site uses HTTPS with a good SSL configuration but lacks DNSSEC. From a security perspective, the site follows basic best practices such as HTTPS and no exposed sensitive data. However, it lacks published privacy and cookie policies, security headers, and a vulnerability disclosure mechanism, which are areas for improvement. The extensive use of tracking and advertising scripts indicates a moderate to extensive user tracking level, but privacy compliance is currently poor. Overall, Springfield Daily Citizen presents a trustworthy and professional local news platform with a solid technical foundation but requires enhancements in privacy compliance and security transparency to strengthen its security posture and user trust.

30
58
25
55
52
80
100
localnewsspringfieldmomediaonlinenewspapercommunitynews+2 more
WordPressYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+7
2025-10-12T14:23:08.531Z
branco.com favicon

Branco Enterprises Inc.

branco.com

59
Real EstateUnited StatesmediumMEDIUM

Branco Enterprises Inc. is a well-established construction company operating primarily in the Midwest United States, with offices in Neosho and Springfield, Missouri. Founded in 1933, Branco offers a comprehensive range of construction services including general contracting, design-build, construction management, and pre-construction evaluations. The company positions itself as a leader in the regional construction industry, serving sectors such as education, healthcare, community, and commercial projects. Their website reflects a professional and modern digital presence, showcasing project portfolios, safety initiatives, and career opportunities. Technically, the site is built on WordPress with Elementor and integrates advanced tools such as Google Analytics, Google Maps API, and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement, reCAPTCHA on forms, and standard security headers, contributing to a strong security posture. However, the absence of a visible cookie consent mechanism and limited privacy compliance indicators suggest room for improvement in regulatory adherence. The WHOIS data for the domain is unavailable, likely due to privacy protection, which slightly reduces transparency but is common for businesses of this type. Overall, Branco Enterprises presents a credible and professional online presence with a solid foundation for further enhancing privacy and security compliance.

70
58
17
80
62
80
20
constructiongeneralcontractingdesign-buildmissouribrancoenterprises+4 more
WordPressElementorGravity FormsGoogle Maps API+3
2025-10-12T14:22:48.335Z
sgfmuseum.org favicon

Springfield Art Museum

sgfmuseum.org

59
GovernmentUnited StatesmediumMEDIUM

The Springfield Art Museum website serves as the official online presence for a government-affiliated non-profit art museum located in Springfield, Missouri. The site provides information about exhibitions, classes, public programs, and museum expansion updates, targeting the general public and local community members interested in art and cultural activities. The business model is primarily government-supported with public engagement and donation facilitation. The website is moderately mature, having been established in 2013, and maintains consistent branding and trust indicators appropriate for a public institution. Technically, the website is built on the CivicPlus CMS platform and employs common web technologies such as jQuery, AlpineJS, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site is mobile-optimized and accessible, with moderate performance. However, there is room for improvement in SEO and security configurations, particularly in enabling DNSSEC and implementing security headers. From a security perspective, the site uses HTTPS and anti-forgery tokens in forms, but lacks visible security headers and DNSSEC, which are recommended for enhanced protection. Privacy compliance is basic, with no explicit cookie consent mechanism or comprehensive privacy policy, which may pose compliance risks under GDPR. The domain registration is consistent and trustworthy, with no privacy protection, aligning with the public nature of the institution. Overall, the website is professional and trustworthy but would benefit from enhanced privacy and security measures to improve compliance and user trust.

40
35
2
60
72
85
100
museumarteducationgovernmentnon-profit+2 more
jQuery 2.2.4jQuery UI 1.14.1AlpineJS 3.14.1Google Tag Manager+3
2025-10-12T13:16:24.784Z
travefy.com favicon

Travefy, Inc.

travefy.com

73
HospitalityUnited StatesmediumMEDIUM

Travefy, Inc. is a well-established travel software company founded in 2012, specializing in providing integrated SaaS solutions for travel agents, agencies, tour operators, and related hospitality sectors. Their platform consolidates itinerary management, proposals, CRM, and marketing tools into a unified system designed to streamline travel business operations and enhance client engagement. With over 30,000 travel brands worldwide using their services, Travefy holds a strong market position supported by extensive supplier integrations and a dedicated support team. Technically, the website is built on modern web technologies including Webflow CMS, HubSpot, Mixpanel, and Google Tag Manager, hosted on AWS infrastructure. The site demonstrates excellent performance, mobile optimization, and SEO practices. Security is robust with HTTPS enforced, PCI-DSS compliance, and multiple security headers implemented. However, DNSSEC is not enabled, and there is no public security.txt or explicit incident response contact information. The security posture is strong with no detected vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance indicators. Business credibility is high, supported by consistent branding, customer testimonials, and trust signals such as PCI-DSS certification. Overall, Travefy presents a professional, secure, and user-friendly digital presence with a mature technical infrastructure and strong business legitimacy. Strategic recommendations include enabling DNSSEC, publishing a security.txt file, and enhancing transparency around incident response to further strengthen security and trust.

55
68
17
87
77
90
100
travelsoftwaretravelagentscrmitinerary+2 more
Webflow CMSHubSpot AnalyticsMixpanelGoogle Tag Manager+3
2025-10-12T13:15:44.461Z
T

Travel Insured International

travelinsured.com

70
OtherN/amediumMEDIUM

Travel Insured International operates as a travel insurance provider offering plans that cover trip cancellation, baggage, and medical emergencies. The company targets travelers seeking reliable insurance coverage to protect their trips. The website presents a professional and consistent brand image with clear service offerings and a focus on travel insurance solutions. The market position appears established within the travel insurance sector, although domain registration data is missing, which raises questions about domain legitimacy. Technically, the website leverages a modern technology stack including jQuery, Bootstrap, and Sitefinity CMS, alongside multiple third-party analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and Microsoft Clarity. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the website lacks visible security headers and explicit privacy or cookie policies in the provided content, which impacts its security posture and privacy compliance. No WAF or blocking mechanisms are detected, and the site is accessible. The absence of WHOIS registration data is a critical concern for domain trustworthiness, although the website content and structure suggest a legitimate business operation. Overall, the site scores moderately on AI evaluation, with strengths in content quality and technical implementation but weaknesses in security and privacy compliance. Strategic improvements in domain registration transparency, security headers, and privacy policies are recommended to enhance trust and compliance.

65
53
55
80
65
80
100
travelinsuranceinsurancetravelmedicalcoveragebaggagecoverage+1 more
jQuery 3.6.4jQuery UI 1.11.3Bootstrap 5.1.3Bluebird Promise+8
2025-10-12T13:15:03.975Z
pheedloop.com favicon

PheedLoop

pheedloop.com

77
TechnologyCanadamediumLOW

PheedLoop is a well-established Canadian technology company specializing in comprehensive event, community, and learning management software. Their platform supports hybrid, virtual, and on-site events with a broad suite of features including registration, mobile apps, streaming, badges, exhibitor and sponsor management, and learning accreditation. The company targets a diverse audience including corporations, associations, government entities, educational institutions, and non-profits. With over 10 years of market presence, PheedLoop positions itself as a mature SaaS provider in the event management industry. Technically, the website is built on Webflow CMS and leverages a modern technology stack including Google Analytics, Facebook Pixel, Microsoft Clarity, and other marketing and analytics tools. Hosting is provided via Amazon AWS infrastructure, ensuring reliable performance and scalability. The site is mobile-optimized with excellent design quality and user experience, reflecting a high level of digital maturity. From a security perspective, the site enforces HTTPS and uses reputable third-party services. However, there are areas for improvement such as enabling DNSSEC, implementing a Content-Security-Policy header, and publishing explicit security and incident response policies. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. Overall, PheedLoop demonstrates a strong business credibility and trustworthy online presence. The domain registration data supports legitimacy, and the website content is professional and safe for general audiences. Strategic recommendations include enhancing DNS security, formalizing security policies, and improving transparency around vulnerability disclosures to further strengthen trust and security posture.

60
100
47
70
77
75
100
eventmanagementvirtualeventshybrideventscommunitymanagementlearningmanagement+2 more
Webflow CMSGoogle AnalyticsGoogle Tag ManagerFacebook Pixel+6
2025-10-12T13:13:41.924Z