Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157331
Websites
130
Industries
113
Countries
52
Avg Score
Page 743 of 1003|Showing 37101-37150 of 50115
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

54
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
klopp.law favicon

Klopp Law

klopp.law

53
OtherUnited StatessmallMEDIUM

Klopp Law is a veteran-owned criminal defense law firm based in Reading, Pennsylvania, specializing in defending clients against serious criminal charges such as drug offenses, gun cases, assaults, and DUI. The firm positions itself as a dedicated and aggressive advocate for clients in eastern Pennsylvania, emphasizing personalized legal representation and thorough case preparation. The website reflects a small but professional legal practice with a clear focus on criminal defense services. Technically, the website is built on WordPress using the PaperStreet theme framework, incorporating modern web technologies such as jQuery, Swiper.js for sliders, and lazy loading for images. SEO is well addressed with Yoast SEO plugin integration and proper meta tags. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Hosting is likely through GoDaddy, consistent with the domain registrar information. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks DNSSEC, visible security headers, and dedicated security or incident response policies. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms. The domain WHOIS data is consistent with the business claims, showing no privacy protection and a legitimate registration history. Overall, Klopp Law's website is a solid representation of a small legal practice with good business credibility and technical implementation but requires improvements in privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
70
52
75
100
legalcriminaldefenselawfirmpennsylvaniaveteran-owned+1 more
WordPressYoast SEO pluginjQuerySwiper.js+3

Partner Domains:

clients.clio.com
partner
app.clio.com
partner

+2 more partners

2025-07-07T10:08:46.369Z
mgwl.com favicon

McGill Gotsdiner Workman & Lepp P.C. L.L.O.

mgwl.com

57
OtherUnited StatesmediumMEDIUM

McGill Gotsdiner Workman & Lepp P.C. L.L.O. is a well-established Nebraska-based law firm specializing in corporate, business, estate planning, health care, employment, litigation, and real estate legal services. The firm targets entrepreneurs and businesses seeking comprehensive legal counsel and has been operating since 1975, positioning itself as a trusted regional legal service provider. The website reflects a professional and client-focused approach with detailed attorney profiles and multiple practice areas. Technically, the site is built on WordPress and leverages modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA for security on contact forms. The site is mobile optimized and demonstrates good SEO practices with structured data markup. Security posture is solid with HTTPS enforced and use of CAPTCHA, though explicit security headers are not detected, and privacy compliance could be improved with cookie consent mechanisms. The absence of WHOIS registration data is a notable inconsistency that slightly impacts trust but does not overshadow the professional presentation and content quality. Overall, the website is a credible digital presence for a mid-sized law firm with room for enhancement in privacy and security transparency.

15
35
17
75
52
80
100
lawlegalcorporatebusinessestateplanning+5 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA v3+2

Partner Domains:

www.lawfirmessentials.com
partner
www.paperstreet.com
partner
2025-07-07T10:08:41.355Z
crossandsmith.com favicon

Cross & Smith LLC

crossandsmith.com

55
OtherUnited StatessmallMEDIUM

Cross & Smith LLC is a well-established personal injury law firm operating primarily in Alabama with offices in Tuscaloosa and Birmingham. The firm specializes in accident and injury cases, boasting over 25 years of experience and significant verdicts and settlements exceeding $150 million. Their business model is client-focused with a contingency fee structure, targeting individuals seeking legal representation for personal injury matters. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, supporting a strong market position in the regional legal services sector. Technically, the website is built on WordPress using a custom theme by PaperStreet, incorporating modern web technologies such as Yoast SEO for search optimization, Google reCAPTCHA for form security, and CallRail for call tracking. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some accessibility features are basic and there is room for improvement in performance and security headers. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms from spam. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers like HSTS and CSP, and the lack of a published security or incident response policy, indicate areas for enhancement. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism or GDPR-specific disclosures. Overall, the website is trustworthy and professional, with a solid business credibility score. Strategic improvements in privacy compliance, security header implementation, and incident response transparency would further strengthen the firm's digital security posture and regulatory adherence.

15
35
17
70
42
75
100
personalinjurylawfirmlegalservicesalabamaattorneys+2 more
WordPressYoast SEOFontAwesomeGoogle reCAPTCHA+2
2025-07-07T10:08:16.290Z
registerplanninglaw.com favicon

Register Law, LLC

registerplanninglaw.com

57
Real EstateUnited StatessmallMEDIUM

Register Law, LLC is a small legal services firm specializing in estate and business planning, trust administration, and prenuptial agreements. The firm positions itself as a thoughtful and personalized planning service provider, emphasizing the client's identity and legacy beyond tax considerations. The website reflects a professional and consistent brand image targeting individuals and businesses in the United States seeking legal planning services. Technically, the website is built on WordPress and uses common web technologies such as jQuery, Google Analytics, and Font Awesome. The site is mobile optimized with good SEO practices but lacks some accessibility features and security headers. Security posture is generally good with HTTPS enforced and no visible vulnerabilities, but the absence of security headers and privacy compliance mechanisms are notable gaps. The WHOIS data is missing, which raises concerns about domain legitimacy and registration status, although the website content and presentation suggest a legitimate business. Contact information is clearly provided with multiple physical addresses and verified company emails and phone numbers. Overall, the website scores moderately well but would benefit from improved privacy compliance and enhanced security practices.

15
35
17
70
72
75
100
estateplanningbusinessplanningtrustadministrationprenuptialagreementslegalservices+1 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle WebFont Loader+1
2025-07-07T10:08:11.280Z
ffslawfirm.com favicon

Fridman Fels & Soto, PLLC

ffslawfirm.com

60
FinanceUnited StatessmallMEDIUM

Fridman Fels & Soto, PLLC is a boutique law firm specializing in white collar criminal defense, securities litigation, and complex investigations, primarily serving U.S. and Latin American clients. Founded in 2019 by former federal prosecutors, the firm emphasizes personalized client service and expertise in criminal and commercial law. Their market position is that of a specialized, trusted legal service provider with a strong reputation bolstered by client testimonials and industry citations. Technically, the website is built on WordPress with a modern tech stack including Bootstrap, WPBakery Page Builder, and Slider Revolution. Hosting appears to be via WP Engine, ensuring reliable performance. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Analytics and marketing tools such as Google Analytics and HubSpot are integrated, indicating moderate user tracking. From a security standpoint, the site uses HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled and no explicit security headers were detected, suggesting room for improvement. Privacy compliance is weak due to the absence of visible privacy and cookie policies. No incident response or vulnerability disclosure information is published. Overall, the website presents a professional and trustworthy image with good business credibility but could enhance its privacy and security posture to meet higher compliance standards.

15
50
17
60
75
80
100
lawfirmwhitecollardefenselitigationmiamilegalservices+2 more
WordPressPHPjQueryBootstrap+5
2025-07-07T10:07:46.145Z
younglegalpllc.com favicon

Young Legal, PLLC

younglegalpllc.com

55
Real EstateUnited StatessmallMEDIUM

Young Legal, PLLC is a small law firm based in North Carolina specializing in business law, real estate, and litigation services. The firm targets individuals and businesses primarily in the Raleigh-Durham area, offering legal representation, strategic counsel, and flexible payment options including monthly subscription plans and personal injury consultations. The website presents a professional and consistent brand image with clear contact information and client testimonials, positioning the firm as a trustworthy local legal service provider. Technically, the website is built on WordPress using the PaperStreet theme, hosted on Bluehost, and incorporates modern web technologies such as Google Analytics and Font Awesome. While the site is mobile-optimized and performs moderately well, there are areas for improvement in accessibility and SEO. Security-wise, the site uses HTTPS and domain locks but lacks DNSSEC and important security headers, and does not provide a security policy or incident response information. Privacy compliance is limited, with no cookie consent mechanism and only a basic privacy/disclaimer page. Overall, the website is functional and credible but would benefit from enhanced security and privacy features to improve trust and compliance.

20
35
2
85
72
50
100
lawfirmlegalservicesbusinesslawrealestatelawlitigation+3 more
Google AnalyticsGoogle Tag ManagerjQuerySlick Slider+2

Partner Domains:

secure.lawpay.com
partner
lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:10.979Z
salazar.law favicon

Salazar Law

salazar.law

57
FinanceUnited StatessmallMEDIUM

Salazar Law is a specialized boutique law firm based in Miami, Florida, focusing on high-stakes financial restructuring, litigation, cryptocurrency-related legal challenges, and government investigations. The firm has a strong market position with over $1 billion in judgments and settlements and over $10 billion in debt restructured, serving businesses and individuals with complex legal needs. Their key services include strategic restructuring, high-stakes litigation, and cryptocurrency litigation and recovery. The website reflects a professional and consistent brand image targeting business clients in the finance and legal sectors. Technically, the website employs modern web technologies including Google Analytics, Google Tag Manager, Google reCAPTCHA, and the Foundation CSS framework. The site is mobile optimized with good navigation and SEO practices, though performance is moderate. Security posture is solid with HTTPS enforced and use of reCAPTCHA, but lacks some security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, the site shows no critical vulnerabilities or exposed sensitive data. However, the absence of privacy and cookie policies and incident response information indicates compliance gaps. The WHOIS data is unavailable, likely due to privacy protection, which is common and justified for law firms. Overall, the site is trustworthy and professional but would benefit from enhanced transparency and security best practices. Strategically, the firm should prioritize publishing comprehensive privacy and cookie policies, implement security headers, and provide incident response and vulnerability disclosure information to strengthen compliance and trust. Enhancing accessibility and performance would further improve user experience and SEO effectiveness.

30
35
2
70
67
70
100
lawlegalfinancialrestructuringlitigationcryptocurrency+2 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAjQuery+2

Partner Domains:

secure.lawpay.com
partner
www.lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:05.970Z
whova.com favicon

Whova

whova.com

73
TechnologyUnited StatesmediumMEDIUM

Whova is a well-established technology company founded in 2012, specializing in providing an all-in-one event management platform that supports in-person, hybrid, and virtual events. Their platform includes award-winning event apps, registration and ticketing software, event management tools, marketing solutions, and exhibitor management. The company targets a broad range of event organizers including corporate, academic, government, association, and trade show sectors. Whova has a strong market position supported by industry awards, customer testimonials, and press coverage. Technically, the website is built on WordPress using the Divi theme and leverages modern web technologies including jQuery, Google Fonts, and YouTube APIs. Hosting is via AWS infrastructure, and the site demonstrates good performance, mobile optimization, and SEO practices. Privacy and cookie compliance are robust, with a clear cookie consent mechanism and comprehensive privacy policies. From a security perspective, the site uses HTTPS with good SSL configuration but lacks DNSSEC and some advanced security headers. No vulnerabilities or exposed sensitive data were detected. However, the absence of a public incident response or vulnerability disclosure policy is noted. Overall, the security posture is solid but could be improved with additional transparency and DNS security. The website is professional, trustworthy, and safe for general audiences. It employs extensive user tracking for analytics and marketing purposes but maintains GDPR compliance. Contact information is clearly provided, including a company email and phone number. Social media presence on Twitter and LinkedIn supports engagement and trust. Strategic recommendations include enabling DNSSEC, adding security headers, publishing incident response and vulnerability disclosure information, and continuing to enhance privacy transparency to maintain and improve trust and security posture.

70
80
2
85
67
90
100
eventmanagementeventappeventregistrationhybrideventsvirtualevents+3 more
WordPressDivi ThemejQueryYouTube iframe API+6
2025-07-07T09:02:44.772Z
F

Federal Reserve Bank of St. Louis

askthefed.org

69
FinanceUnited StatesenterpriseMEDIUM

Ask the Fed® is an educational program operated by the Federal Reserve Bank of St. Louis, providing financial and regulatory updates to bankers and their boards through webinars and conference calls. The website serves as a login portal for registered users to access these resources. The business operates under the Federal Reserve System umbrella, positioning itself as a trusted authority in the finance sector. The content is professional, targeted, and consistent with the Federal Reserve's branding and mission. Technically, the website uses a modern but somewhat dated tech stack including AngularJS, jQuery, and Bootstrap. The site is moderately optimized for performance and mobile use, though accessibility features appear basic. Security practices include use of anti-forgery tokens and secure form submission, but visible security headers and cookie consent mechanisms are lacking. The WHOIS data is unavailable due to privacy or query failure, but the domain is a subdomain of a legitimate Federal Reserve domain, supporting its authenticity. Security posture is moderate with room for improvement in headers and transparency around incident response. No vulnerabilities or malicious content were detected. Privacy compliance is good with a clear privacy policy and contact information, though cookie consent is missing. Overall, the site is trustworthy and professionally maintained, suitable for its audience. Risk is low but recommendations include enhancing security headers, adding cookie consent, and publishing security policies to improve compliance and trust further.

55
53
17
70
95
85
100
financebankingfederalreservewebinarlogin+2 more
jQueryBootstrapAngularJSModernizr
2025-07-07T08:59:43.496Z
paintrite.co.nz favicon

Paintrite NZ Limited

paintrite.co.nz

55
Real EstateNew ZealandsmallMEDIUM

Paintrite NZ Limited is a small, family-operated painting service company specializing in residential and commercial painting in the Auckland and Coromandel regions of New Zealand. With over 25 years of experience, the company offers a broad range of services including interior and exterior painting, roof painting, plastering, and restoration. The website positions the company as a trusted local provider with certifications such as Dulux Accredited Painter and Ebix Trades Monitor approval, enhancing its credibility in the market. Technically, the website is built on WordPress using the Oxygen Builder framework, leveraging modern web technologies such as jQuery and Google Fonts. The site is mobile-optimized with good SEO practices and moderate performance. Hosting and domain registration are handled by reputable providers, with Cloudflare DNS in use, though DNSSEC is not enabled. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks visible security headers and formal privacy or cookie policies, indicating areas for compliance and security improvement. No forms are present on the homepage, reducing immediate data collection risks, but the absence of privacy and cookie policies may expose the company to regulatory scrutiny. Overall, the website is professional and trustworthy with a solid business presence but would benefit from enhanced privacy compliance and security hardening to align with best practices and regulatory requirements.

70
35
2
40
52
60
100
paintinghousepaintersaucklandcoromandelcommercialpainting+4 more
jQueryOxygen BuilderGoogle FontsAOS (Animate On Scroll)+1
2025-07-07T07:54:45.980Z
nocowboys.co.nz favicon

NoCowboys Limited

nocowboys.co.nz

57
OtherNew ZealandmediumMEDIUM

NoCowboys Limited operates an online platform dedicated to connecting New Zealand residents with trusted tradespeople and businesses, including builders, mechanics, painters, and plumbers. The website serves as a comprehensive rating and review site, positioning itself as the original Kiwi rating platform with a substantial number of user-generated ratings. Its business model revolves around facilitating informed decisions for consumers and providing marketing support for businesses through reputation management and job posting services. Technically, the website employs a modern JavaScript stack including jQuery, Google Tag Manager, Facebook SDK, and Google reCAPTCHA to enhance user interaction and security. The site is mobile-optimized with good SEO practices and a professional design, although accessibility features are basic. Performance is moderate, and the site uses HTTPS, but lacks some advanced security headers. From a security perspective, the site benefits from HTTPS and reCAPTCHA integration but lacks explicit security policies, incident response contacts, and cookie consent mechanisms, which are important for compliance and user trust. The absence of WHOIS data for the domain raises concerns about domain legitimacy and registration transparency, impacting overall trustworthiness. Overall, NoCowboys presents a professional and trustworthy front for its business niche but should address privacy compliance and security best practices to enhance user confidence and regulatory adherence.

30
35
17
70
65
65
100
tradespeoplebusinessreviewsnewzealandbuildersplumbers+4 more
jQueryjQuery UIGoogle Tag ManagerFacebook SDK+2
2025-07-07T07:54:35.959Z
forsythbarrstadium.co.nz favicon

Forsyth Barr Stadium

forsythbarrstadium.co.nz

60
HospitalityNew ZealandmediumMEDIUM

Forsyth Barr Stadium is a prominent event venue located in Dunedin, New Zealand, known for hosting a wide range of sports, concerts, conferences, and community events. The stadium offers unique features such as a real grass field under a transparent roof and provides services including venue hire, membership programs, and hospitality. The website reflects a well-established business with a domain age since 2009, consistent with its market presence. Technically, the website is built on the SilverStripe CMS platform and leverages modern web technologies including Bootstrap, jQuery, and Font Awesome. It integrates multiple analytics and tracking tools such as Google Analytics, Facebook Pixel, and Hotjar, indicating a mature digital marketing approach. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. From a security perspective, the website uses HTTPS and Cloudflare for DNS and CDN services, but lacks DNSSEC and explicit security headers, which are recommended to enhance security posture. Privacy compliance is partial, with a privacy policy present but no visible cookie consent mechanism, which could be improved to meet GDPR standards fully. No incident response or vulnerability disclosure information is provided. Overall, Forsyth Barr Stadium's website is credible, professionally maintained, and serves its business purpose effectively. Strategic improvements in security headers, DNSSEC, and privacy compliance would further strengthen its security and trustworthiness.

50
53
2
60
65
65
100
eventvenuestadiumnewzealandsportsconcerts+2 more
HTML5CSS3JavaScriptjQuery+7
2025-07-07T07:54:20.933Z
alm.com favicon

ALM Global, LLC

alm.com

73
MediaUnited StateslargeMEDIUM

ALM Global, LLC operates a comprehensive media and intelligence platform focused primarily on the legal industry, delivering data, insights, marketing solutions, and events to a global audience of business leaders and practicing professionals. The company positions itself as a leading authority in the business of law, supported by a heritage of over 100 years and a strong digital presence. The website is professionally designed, content-rich, and optimized for user engagement, targeting legal professionals and related sectors. Technically, the website is built on WordPress with modern plugins and integrations including Yoast SEO, Tealium tag management, and Google Analytics. The site demonstrates good mobile optimization and SEO practices, though some accessibility features could be enhanced. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security headers and publicly available security policies or incident response information. Overall, the site reflects a mature digital infrastructure with moderate to good security and privacy compliance. The absence of WHOIS data due to privacy protection is typical for media companies and does not detract from the site's legitimacy. The business credibility is supported by consistent branding, social media presence, and clear market positioning. Recommendations include improving security headers, publishing security policies, and enhancing accessibility to further strengthen trust and compliance.

90
68
17
80
65
85
100
medialegalbusinessintelligenceevents+2 more
WordPress 6.7.1Google FontsjQueryYoast SEO plugin+4
2025-07-07T07:51:55.602Z
frbservices.org favicon

Federal Reserve Banks

frbservices.org

73
FinanceUnited StatesenterpriseMEDIUM

The Federal Reserve Financial Services website represents the official online presence of the Federal Reserve Banks' financial services division. It provides comprehensive information and access to a wide range of financial services targeted primarily at depository institutions and banks. The site highlights key services such as electronic fund transfers, check collection, cash and coin distribution, and newer offerings like the FedNow Service. The Federal Reserve Banks hold a dominant market position as the central banking authority in the United States, and this website serves as a critical resource for their institutional customers. Technically, the website employs a modern technology stack including Bootstrap for responsive design, jQuery, and integrates multiple analytics tools such as Google Analytics and LinkedIn Insight Tag. The site is mobile-optimized and accessible, with good SEO practices evident in meta tags and structured navigation. Hosting and DNS services are provided by reputable providers, and the domain is well-established with a creation date in 1998. From a security perspective, the site enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, it lacks DNSSEC and certain security headers that could enhance protection. There is no publicly available security policy or incident response information, nor a vulnerability disclosure program. Privacy compliance is basic, with a clear privacy policy but no cookie consent mechanism detected. The use of privacy protection in WHOIS is justified given the nature of the organization. Overall, the website is professional, trustworthy, and well-maintained, with a strong business credibility score. Recommendations include enabling DNSSEC, adding security headers, publishing security policies, and implementing a vulnerability disclosure mechanism to further strengthen security posture and compliance.

80
53
10
70
100
85
100
federalreservefinancialservicesbankingfedwirefedach+4 more
Google AnalyticsGoogle Tag ManagerjQueryBootstrap+2
2025-07-07T07:51:05.396Z
dallasfed.org favicon

Federal Reserve Bank of Dallas

dallasfed.org

69
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of Dallas website serves as the official digital presence of one of the twelve regional Reserve Banks in the United States. It provides authoritative economic research, data, community development initiatives, banking supervision resources, and educational materials targeted at economists, policymakers, bankers, and the public within the Eleventh Federal Reserve District. The site is well-branded, professionally designed, and offers comprehensive content that supports its role as a government entity within the Federal Reserve System. Technically, the website employs modern web technologies including Bootstrap for responsive design, Google Analytics and Tag Manager for user tracking, and embeds multimedia content via Vimeo. The site is mobile-optimized and accessible, with clear navigation and SEO best practices. However, some security best practices such as explicit security headers and cookie consent mechanisms could be improved. From a security perspective, the site uses HTTPS exclusively and does not expose sensitive data in its HTML content. The absence of WHOIS data due to a malformed WHOIS response limits domain registration insights, but the strong official branding and consistent content quality support its legitimacy. No WAF or blocking mechanisms were detected, allowing full content access. Overall, the website demonstrates a strong security posture and high business credibility, with minor areas for improvement in privacy compliance and security header implementation. The risk level is low, and the site is trustworthy for its intended audience.

65
53
2
70
95
85
100
federalreserveeconomybankingtexasenergy+3 more
Google AnalyticsGoogle Tag ManagerBootstrap (CSS/JS)jQuery+1
2025-07-07T07:51:00.378Z
lbresearch.com favicon

Law Business Research

lbresearch.com

71
TechnologyUnited KingdomlargeMEDIUM

Law Business Research (LBR) is a UK-based technology-driven information services company specializing in providing intelligence and insights to the global legal, intellectual property, and governance, risk, and compliance markets. The company offers a range of platforms and tools designed to help legal professionals, law firms, corporates, academics, and government agencies make informed decisions through data-driven insights. LBR positions itself as a fast-growing and innovative leader in its sector, serving a diverse and international client base including major law firms and FTSE100 companies. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics. The presence of Cloudflare bot management cookies suggests a robust hosting and security infrastructure. The site is mobile-optimized and demonstrates good performance and accessibility standards, although some security headers could be improved. Privacy compliance is well addressed with clear cookie consent mechanisms and comprehensive privacy and cookie policies. From a security perspective, the site enforces HTTPS and employs cookie consent blocking for scripts until user approval. However, it lacks explicit security policy documentation and incident response contacts, which are recommended for enhanced trust and compliance. The absence of WHOIS registration data raises minor concerns but does not critically impact the overall legitimacy given the professional presentation and business information. Overall, LBR's website reflects a mature digital presence with strong business credibility and compliance posture, suitable for its professional audience. Strategic improvements in security transparency and WHOIS registration clarity would further enhance trust and security posture.

60
80
17
80
65
80
100
legalresearchintelligencetechnologycompliance+4 more
WordPressYoast SEO pluginjQueryCloudflare (inferred from cookie __cf_bm)+3
2025-07-07T07:50:35.256Z
F

Fuse Creative

fusecreative.co.nz

44
MediaNew ZealandsmallHIGH

Fuse Creative is a small Auckland-based brand design and creative agency established in 2006. The company offers services in brand strategy and design, advertising and marketing, and engagement and culture change. Their website presents a professional portfolio showcasing various projects for clients, indicating a solid market presence in the New Zealand media sector. The business targets organizations seeking creative brand and marketing solutions, positioning itself as a creative partner to grow brands and sales. Technically, the website employs common web technologies including jQuery, Bootstrap, Google Fonts, and Slider Revolution for dynamic content presentation. It integrates third-party analytics and tracking tools such as Google Analytics, Google Tag Manager, and LinkedIn Insight. The site appears moderately optimized for mobile devices and SEO, with good navigation and content quality. Hosting is provided by a New Zealand-based registrar, Voyager Internet Ltd. From a security perspective, the site lacks visible security headers and does not have DNSSEC enabled, which are areas for improvement. The SSL configuration could not be confirmed from the data provided. No privacy or cookie policies are present, indicating potential compliance gaps with GDPR and other privacy regulations. No contact emails or phone numbers are explicitly listed, which may affect user trust and communication. Overall, the website is professionally designed and functional but requires enhancements in security posture and privacy compliance to improve trustworthiness and regulatory adherence. Strategic recommendations include implementing security headers, enabling DNSSEC, adding privacy and cookie policies, and providing clear contact information to strengthen the site's credibility and user confidence.

25
35
2
75
62
65
20
branddesigncreativeagencymarketingadvertisingculturechange+2 more
jQueryBootstrapGoogle FontsSlider Revolution+1
2025-07-07T07:50:00.173Z
aiatsis.gov.au favicon

Australian Institute of Aboriginal and Torres Strait Islander Studies

aiatsis.gov.au

63
GovernmentAustraliamediumMEDIUM

The Australian Institute of Aboriginal and Torres Strait Islander Studies (AIATSIS) is Australia's sole national institution dedicated to the history, culture, and heritage of Aboriginal and Torres Strait Islander peoples. It operates as a government-funded entity providing extensive research, educational resources, and cultural heritage services. The website reflects a strong market position as a trusted custodian and leader in Indigenous Australian studies, targeting researchers, educators, Indigenous communities, and the general public. Key services include family history research support, collection access, educational curriculum resources, and cultural heritage repatriation programs. Technically, the website is built on Drupal 10 with modern JavaScript libraries and integrates Google Analytics, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a moderate performance profile. Hosting details are not explicitly stated but the domain is managed by the Australian Department of Finance with DNS via netregistry.net. From a security perspective, the site enforces HTTPS with strong SSL configuration and uses Content Security Policy nonces to mitigate script injection risks. However, DNSSEC is not enabled, and there is no visible cookie consent mechanism or published vulnerability disclosure policy. The WHOIS data confirms the domain is registered to a legitimate government entity with domain status protections, enhancing trustworthiness. Overall, AIATSIS's website is professional, content-rich, and secure, with minor gaps in privacy compliance and vulnerability disclosure. It serves as a reliable digital platform for Indigenous cultural and research engagement in Australia.

70
53
17
65
42
75
100
aboriginaltorresstraitislanderindigenousresearcheducation+3 more
Drupal 10jQuerySlick CarouselGoogle Tag Manager+3

Partner Domains:

shop.aiatsis.gov.au
partner
2025-07-07T07:49:05.059Z
earlychildhoodaustralia.org.au favicon

Early Childhood Australia

earlychildhoodaustralia.org.au

61
EducationAustraliamediumMEDIUM

Early Childhood Australia is a well-established non-profit organization dedicated to advocacy, professional development, and resource provision for early childhood education in Australia. The website serves as a comprehensive platform offering publications, events, membership services, and educational resources targeted at educators, parents, and policymakers. The organization maintains a strong market position as a national peak body in its sector. Technically, the website is built on WordPress with a modern technology stack including Bootstrap, jQuery, and various analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and Hotjar. The site demonstrates good performance, mobile optimization, and accessibility features, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS, uses Google reCAPTCHA on forms, and integrates tracking pixels responsibly. While explicit security headers are not fully visible in the provided content, the overall posture is good with no evident vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR considerations. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. Strategic recommendations include enhancing security headers, publishing a formal security policy and vulnerability disclosure, and continuing regular security audits to maintain and improve the security posture.

15
65
17
70
72
60
100
educationnon-profitearlychildhoodadvocacyprofessionaldevelopment+1 more
WordPressPHPjQueryBootstrap 3.4.1+7

Partner Domains:

shop.earlychildhoodaustralia.org.au
partner
learninghub.earlychildhoodaustralia.org.au
partner

+3 more partners

2025-07-07T07:48:50.029Z
T

Tablebooker bv

weresmartcera.be

59
HospitalityBelgiumsmallMEDIUM

We're Smart® Cera is a Belgian event campaign promoting restaurants that emphasize vegetables and fruits, running from October 2024 to February 2025 with 35 participating restaurants. The website serves as an informational and promotional platform targeting consumers interested in healthy dining options. The business operates in the hospitality and non-profit sectors, with Tablebooker bv as the organizing entity. The site is multilingual and provides partner information and contact details, supporting consumer engagement and event awareness. Technically, the website uses a modern JavaScript stack including jQuery, RequireJS, and a cookie consent library, with external resources loaded from reputable CDNs. The site is moderately optimized for performance and mobile devices, with basic accessibility and SEO features. Cookie consent mechanisms are implemented, supporting GDPR compliance. However, no explicit security headers or advanced security policies are evident. From a security perspective, the site uses HTTPS and includes cookie consent with opt-in/out options, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the HTML content. The WHOIS data shows a consistent and legitimate domain registration aligned with the business timeline, enhancing trustworthiness. Overall, the website is professional, trustworthy, and compliant with basic privacy requirements. Recommendations include enhancing security headers, adding terms of service and security policies, improving accessibility, and regularly auditing third-party scripts to maintain security and compliance.

65
25
2
60
67
75
100
restauranthealthyeatingeventbelgiumcookieconsent+1 more
JavaScriptjQueryRequireJSCookieConsent (orestbida)+1

Partner Domains:

weresmartworld.com
partner
www.cera.coop
partner

+1 more partners

2025-07-07T07:48:45.021Z
vzwrozemarijn.be favicon

vzw Rozemarijn

vzwrozemarijn.be

55
Non-profitBelgiumsmallMEDIUM

vzw Rozemarijn is a Belgian non-profit organization dedicated to providing care and support services for adults with disabilities in the Vlaams-Brabant region, specifically in Keerbergen and Haacht. Their key offerings include day support, residential support, care purchasing, guided work, enclave work, and semi-industrial work, targeting a niche audience requiring specialized assistance. The website reflects a professional and consistent brand image with clear contact details and structured data enhancing credibility. Technically, the website employs modern JavaScript frameworks such as Vue.js and jQuery, integrates Google Tag Manager for analytics, and uses HTTPS with a cookie consent mechanism, indicating a moderate level of digital maturity. The site is mobile-optimized with good SEO practices but lacks some advanced security headers that could further harden its posture. From a security perspective, the site enforces HTTPS and provides cookie consent aligned with GDPR requirements. However, the absence of explicit security policies, incident response contacts, and vulnerability disclosure mechanisms suggests room for improvement in security transparency and readiness. The WHOIS data is restricted, limiting domain trust verification, but the website content and contact information appear legitimate and consistent with the organization's mission. Overall, the website scores well in content quality, privacy compliance, and business credibility, with moderate technical and security scores. Strategic enhancements in security headers, published policies, and WHOIS transparency would strengthen trust and resilience.

40
83
2
70
52
75
40
non-profitdisabilitysupportcareservicesbelgiumprivacy+2 more
jQueryVue.jsAxiosGoogle Tag Manager+1
2025-07-07T07:47:44.855Z