Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 10 of 17|Showing 451-500 of 825
iss.lv favicon

SIA Industrial Smart Solution

iss.lv

41
ManufacturingLatviasmallHIGH

Industrial Smart Solutions (SIA Industrial Smart Solution) is a Latvian company specializing in industrial construction and full-cycle industrial project development. The company offers a broad range of services including project management, industrial concrete works, building reconstruction, and specialized industrial tasks. Their portfolio includes over 30 industrial projects such as industrial complexes, parks, warehouses, and sports facilities, positioning them as a competent regional player in the manufacturing and construction sectors. Technically, the website employs a simple but effective technology stack including jQuery and Google Fonts, with a responsive design and moderate performance. However, the site lacks advanced security headers and privacy policies, indicating room for improvement in digital maturity and compliance. No analytics or tracking scripts were detected, suggesting minimal user tracking. From a security perspective, the site uses HTTPS but lacks visible security headers and privacy compliance mechanisms. No incident response or vulnerability disclosure information is provided. The absence of WHOIS data due to query limits limits domain trust analysis, but the available business information and contact details support legitimacy. Overall, the website is professional and informative but would benefit from enhanced security practices, privacy compliance, and transparency to improve trust and reduce risk.

20
10
2
85
47
75
20
industrialconstructionbuildingservicesprojectmanagementlatviaconstructioncompany
jQuery 2.2.4Google Fonts (Open Sans)CSS minified stylesheet
2025-07-30T16:00:31.272Z
kravasbusunoma.lv favicon

Bus4rent.lv

kravasbusunoma.lv

54
TransportationLatviasmallMEDIUM

The website www.kravasbusunoma.lv represents a Latvian cargo van rental business operating under the brand Bus4rent.lv. It offers a variety of cargo vans, refrigerated vans, passenger cargo buses, and trailers for short and long-term rental. The company positions itself as a professional and leading service provider in Latvia with over 14 years of experience, targeting local and international customers needing cargo transportation solutions. The website provides detailed service descriptions, pricing tables, and multiple contact channels including phone, email, and a contact form, supporting customer engagement and service inquiries. Technically, the website is built on the Mozello CMS platform and uses Amazon CloudFront CDN for content delivery. It employs common JavaScript libraries such as jQuery and Fancybox, and integrates Google Analytics for visitor tracking. The site is mobile-optimized with responsive design elements and includes a cookie consent banner, indicating some level of privacy compliance. However, no explicit privacy policy page was found, which is a compliance gap. Security headers are not detected in the provided data, suggesting opportunities for improving security hardening. From a security posture perspective, the site uses HTTPS and client-side form validation, but lacks advanced security headers and published security policies or incident response contacts. No WHOIS data was available due to query limits, limiting domain registration trust verification. The content is safe for general audiences with no adult or questionable material detected. Overall, the website is functional, professional, and moderately secure but would benefit from enhanced privacy and security practices. Strategically, the business should prioritize publishing a comprehensive privacy policy, implementing security headers, and establishing incident response contacts to improve trust and compliance. Enhancing server-side validation and security monitoring would further strengthen the security posture. These steps will help maintain customer confidence and regulatory compliance while supporting business growth in the competitive cargo rental market.

20
25
2
60
75
75
100
cargovanrentalvehiclerentaltransportationlatvialogistics+1 more
jQuery 2.2.4Fancybox 3BannerplayResponsiveVideos+1
2025-07-30T16:00:30.101Z
fieldandforest.lv favicon

SIA FIELD AND FOREST

fieldandforest.lv

10
OtherLatviasmallCRITICAL

SIA FIELD AND FOREST is a Latvian-based small business specializing in organic agriculture, particularly the cultivation and processing of medicinal and aromatic plants such as German chamomile. Founded in 2005, the company positions itself as a leading Northern European chamomile grower and producer of essential oils and bio-solutions. Their website reflects a professional and consistent brand image with a focus on sustainability and natural products. The target audience includes consumers and businesses interested in organic and natural health products primarily in Latvia and Northern Europe. Technically, the website is built on the Mozello CMS platform, leveraging modern JavaScript libraries and Amazon Cloudfront CDN for hosting. It is mobile-optimized and includes accessibility features, with moderate performance and good SEO practices. Security posture is adequate with HTTPS enforced and cookie consent mechanisms in place, though some security headers are missing and no explicit incident response or vulnerability disclosure policies are published. WHOIS data is unavailable due to query limits, but the website content and certifications suggest legitimacy. Overall, the website is safe, professional, and trustworthy with room for improvement in security transparency and contact information visibility.

-
-
-
-
-
-
-
organicagricultureessentialoilsbiologicalfarmingmedicinalplants+1 more
jQuery 2.2.4Fancybox3Google Tag ManagerGoogle Analytics+2
2025-07-30T16:00:28.035Z
travelventspils.lv favicon

Brīvdienu māja PODNIEKI

travelventspils.lv

51
HospitalityLatviasmallMEDIUM

The website travelventspils.lv represents a small family-friendly guest house named Brīvdienu māja PODNIEKI located in Ventspils, Latvia. The business focuses on hospitality services catering primarily to families with children and tourists visiting the region. The site provides accommodation booking information primarily via phone and WhatsApp, with additional tourist information links to the official Ventspils tourism site. The market position is local and niche, targeting visitors seeking a family-oriented stay in Ventspils. Technically, the website is built on the Mozello CMS platform and leverages Amazon CloudFront CDN for content delivery. It uses legacy JavaScript libraries such as jQuery 2.2.4 and plugins like Fancybox3 for UI components. The site is moderately optimized for mobile devices and has basic SEO and accessibility features. However, there is no evidence of advanced frameworks or modern JavaScript technologies. From a security perspective, the site lacks visible security headers and privacy or cookie policies, which are critical for GDPR compliance given its European location. No WHOIS data was retrievable due to query limits, limiting domain legitimacy verification. The site uses HTTPS (implied by canonical URL) but lacks explicit security best practices such as CSP or HSTS headers. Contact information is limited to phone numbers without email or contact forms, reducing attack surface but also limiting user engagement options. Overall, the website is functional and appropriate for its business purpose but shows gaps in privacy compliance and security hardening. The absence of WHOIS data and privacy policies reduces trustworthiness from a compliance standpoint. Strategic improvements in security headers, privacy documentation, and WHOIS transparency would enhance the site's credibility and compliance posture.

20
10
2
60
75
75
100
hospitalityguesthousefamilyfriendlyventspilslatvia+2 more
jQuery 2.2.4Fancybox3BannerplayResponsiveVideos+1
2025-07-30T16:00:25.993Z
R

Rīgas 4. pamatskola

r4ps.lv

54
EducationLatviasmallMEDIUM

Rīgas 4. pamatskola is a Latvian primary school providing educational services to children and families in Riga. The website serves as an informational portal offering details about school administration, educational programs, projects such as Erasmus+, and student support services. The target audience includes students, parents, and educational staff within the local community. The school operates as a public educational institution with a focus on primary and preschool education. Technically, the website is built on the Mozello CMS platform and leverages Amazon CloudFront CDN for content delivery. It uses common JavaScript libraries such as jQuery and Fancybox for UI enhancements. The site is moderately optimized for mobile devices and offers a clear navigation structure. However, it lacks advanced SEO and accessibility features and does not appear to use analytics or tracking services. From a security perspective, the site uses HTTPS but lacks visible security headers and cookie consent mechanisms, which are important for GDPR compliance. No forms or sensitive data collection points were detected, reducing immediate risk exposure. The WHOIS data could not be retrieved due to query limits, limiting domain trust verification. Overall, the security posture is basic with room for improvement in headers, consent, and transparency. The overall risk is low given the nature of the site and its content, but improvements in security best practices and privacy compliance would enhance trust and reduce potential vulnerabilities. Strategic recommendations include implementing security headers, adding cookie consent, and improving WHOIS transparency.

75
60
10
100
17
20
75
educationschoolprimaryeducationlatviariga+3 more
jQuery 2.2.4Fancybox 3BannerplayResponsiveVideos
2025-07-30T16:00:25.828Z
montesoripardaugava.lv favicon

SIA “VS Skola”

montesoripardaugava.lv

56
EducationLatviasmallMEDIUM

The website www.montesoripardaugava.lv represents SIA “VS Skola”, an educational institution operating Montessori preschool and primary school programs in Latvia. The business emphasizes Montessori educational principles focusing on child-centered learning and holistic development. The site content is well-structured and targeted at parents seeking Montessori education for their children. The institution appears to be a small-sized local education provider with a niche market position. Technically, the website is built on the Mozello CMS platform, utilizing common JavaScript libraries such as jQuery and Fancybox, and is hosted with Amazon Cloudfront CDN. The site loads Google Analytics and Google Tag Manager scripts for tracking. The website is mobile-optimized and provides a cookie consent mechanism in compliance with basic privacy standards. However, no explicit privacy policy or terms of service pages were found, and no contact emails or phone numbers are provided on the homepage. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks visible security headers such as Content-Security-Policy or X-Frame-Options. No forms or input fields were detected, reducing attack surface, but the absence of a published security or incident response policy is a gap. The WHOIS data could not be retrieved due to query limits, but no suspicious indicators were found in the website content or linked domains. Overall, the website presents a professional and trustworthy educational service with moderate technical maturity and security posture. Strategic improvements include publishing comprehensive privacy and security policies, adding clear contact information, and implementing security headers to enhance trust and compliance.

20
25
2
75
75
80
100
educationmontessoripreschoolprimaryschoollatvia+1 more
jQuery 2.2.4Fancybox 3Google AnalyticsGoogle Tag Manager+1
2025-07-30T16:00:24.823Z
higienasprasibas.lv favicon

Apmācību centrs "Biznesa Izglītība"

higienasprasibas.lv

54
EducationLatviasmallMEDIUM

The website higienasprasibas.lv represents a Latvian small business specializing in licensed online hygiene training courses, primarily targeting professionals in food enterprises and beauty services. The business model revolves around e-learning with digital delivery of course materials and certification, offering convenience and cost-effectiveness. The site is well-structured with clear navigation and content relevant to its niche audience. Technically, the website employs a moderate technology stack including jQuery, Fancybox, and Google Analytics, hosted on Amazon CloudFront CDN ensuring good performance and HTTPS security. Mobile optimization and basic accessibility features are present, though there is room for improvement in security headers and accessibility compliance. From a security perspective, the site enforces HTTPS and cookie consent mechanisms, but lacks explicit security policies, incident response information, and advanced security headers. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data limits domain trust analysis, but the website content and business information appear consistent and legitimate. Overall, the website scores moderately high in content quality, technical implementation, security posture, privacy compliance, and business credibility. Strategic improvements in security headers, accessibility, and transparency of security policies would enhance trust and compliance.

20
25
2
60
75
75
100
educationtraininghygienee-learninglatvia+1 more
jQuery 2.2.4Fancybox 3BannerplayResponsiveVideos+3
2025-07-30T16:00:22.654Z
insaitcentrs.com favicon

SIA "Insait centrs"

insaitcentrs.com

56
EducationLatviasmallMEDIUM

Insait Centrs is a Latvian education development center focused on providing scientifically based educational solutions for preschool and school-age children. The organization offers developmental and educational programs, aiming to make quality learning accessible to a broad segment of Latvian society. Their services include preschool educational programs and pedagogical support, targeting parents, children, and educational institutions within Latvia. The website is professionally designed, mobile-optimized, and includes clear contact information and social media presence, enhancing its credibility. Technically, the website leverages modern JavaScript libraries such as jQuery and Fancybox, hosted on Amazon Cloudfront CDN, and built on the Mozello platform. While performance and mobile optimization are good, some improvements in accessibility and SEO could be made. Security posture is moderate with HTTPS enabled and secure login forms, but lacks important security headers and cookie consent mechanisms, which are recommended for GDPR compliance. The WHOIS data is notably absent, with no registrar or registration dates found, which raises concerns about domain legitimacy despite the professional appearance and valid business information on the site. No WAF or blocking mechanisms were detected, and the site content is safe and appropriate for general audiences. Overall, the site is functional and trustworthy from a user perspective but requires attention to domain registration legitimacy and enhanced security and privacy compliance to improve trustworthiness and reduce risk.

20
35
2
75
75
75
100
educationchildrenlatviapreschoollearning+1 more
jQuery 2.2.4Fancybox 3BannerplayResponsiveVideos+2
2025-07-30T16:00:21.501Z
glassdoctor.lv favicon

SIA Glassdoctor.lv

glassdoctor.lv

56
TransportationLatviasmallMEDIUM

Glassdoctor.lv is a Latvian small business specializing in automotive glass repair and replacement services, including passenger cars, trucks, and tractor equipment. The company operates a modern workshop located at Brīvības gatve 202B, Riga, and offers convenient mobile service options for customers. Their website reflects a local service provider with over 15 years of industry experience, targeting both private individuals and businesses within Latvia, especially in Riga and surrounding areas. The business model focuses on direct service delivery with an emphasis on quality and customer convenience. Technically, the website is built on the Mozello CMS platform, leveraging Amazon Cloudfront CDN for content delivery. It uses common JavaScript libraries such as jQuery and Fancybox for UI enhancements. The site is moderately optimized for performance and mobile devices, with basic SEO and accessibility features. However, it lacks advanced security headers and explicit privacy or security policies, which could be improved to enhance trust and compliance. From a security perspective, the site enforces HTTPS and implements a cookie consent banner, indicating some attention to privacy compliance. No critical vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data due to query limits limits full domain trust assessment, but the website content and contact information appear consistent and professional. Overall, the security posture is moderate but could benefit from additional hardening and transparency. The overall risk assessment is low to moderate, with recommendations to implement explicit privacy and security policies, add security headers, and improve accessibility. These steps would strengthen compliance with GDPR and enhance user trust. The website is suitable for its local service business purpose but should address these gaps to improve its digital maturity and security resilience.

20
40
2
60
75
75
100
autostiklumaiaautostikluremontsvjstiklumaiaizbraukumaservissautostiklutonana+2 more
jQuery 2.2.4Fancybox 3BannerplayResponsiveVideos+1
2025-07-30T16:00:21.002Z
videsizpete.lv favicon

SIA Vides izpēte

videsizpete.lv

54
Real EstateLatviasmallMEDIUM

SIA Vides izpēte is a Latvian company specializing in certified land surveying and geodesy services, including topographic surveying, cadastral land surveying, land management, engineering geodesy, and 3D laser scanning. The company targets clients across Latvia, providing professional surveying solutions primarily for real estate and land management purposes. The website is built on the Mozello CMS platform and hosted via Amazon Cloudfront CDN, incorporating modern web technologies such as jQuery and Google Analytics for tracking and marketing purposes. The site is mobile-optimized and provides clear navigation, though content depth is basic. From a security perspective, the website enforces HTTPS and includes a cookie consent banner, indicating some level of privacy compliance. However, it lacks visible security headers, a privacy policy, terms of service, and contact emails, which are important for trust and regulatory compliance. No WHOIS data was available due to query limits, limiting the ability to fully verify domain legitimacy. No signs of WAF or blocking mechanisms were detected, and the content is safe and professional. Overall, the website presents a functional and moderately secure digital presence for a small Latvian surveying business but would benefit from enhanced privacy disclosures, security headers, and more comprehensive contact information to improve trust and compliance.

20
25
2
70
75
75
100
landsurveyinggeodesylatviamozellorealestateservices
jQuery 2.2.4Fancybox 3Google Tag ManagerGoogle Analytics+1
2025-07-30T16:00:20.989Z
medors.lv favicon

Medors.lv

medors.lv

50
OtherLatviasmallMEDIUM

Medors.lv is a Latvian small business specializing in beekeeping, particularly in breeding and selling bee queens along with traditional bee products such as honey, bee bread, propolis, and wax. The business operates a beekeeping farm managing over 100 bee colonies and several hundred nucs, also cultivating nectar plants on 20 hectares. Their market focus is local and Baltic region beekeepers, offering dynamic availability of bee queens throughout the season. The website presents a professional but modest digital presence with clear navigation and relevant content for its niche audience. Technically, the website uses a Mozello CMS platform with common JavaScript libraries like jQuery and Fancybox, hosted behind Amazon Cloudfront CDN. Google Analytics and Google Tag Manager are used for visitor tracking. The site is mobile optimized and has moderate performance. However, there is a lack of visible advanced security headers and no privacy or cookie policies, which are compliance gaps. The login form exists but lacks visible anti-brute force protections. Security posture is moderate with HTTPS implied but no explicit security headers detected. The absence of privacy and cookie policies reduces privacy compliance scores. WHOIS data could not be retrieved due to query limits, limiting domain legitimacy verification. Overall, the site appears legitimate and safe with no adult or questionable content, but improvements in security and compliance documentation are recommended. Strategic recommendations include implementing security headers, adding privacy and cookie policies, enhancing login security, and publishing a vulnerability disclosure policy to improve trust and compliance.

20
10
2
60
65
75
100
beekeepinghoneybeequeenslatviasmallbusiness+1 more
jQuery 2.2.4Fancybox3Google AnalyticsCloudfront CDN
2025-07-30T16:00:20.396Z
raredarbnica.lv favicon

DEKOMET SIA

raredarbnica.lv

57
ManufacturingLatviamediumMEDIUM

Rare Darbnīca, operated by DEKOMET SIA, is a Latvian-based creative advertising workshop specializing in the production of a wide range of advertising and promotional products. With a team of 33 professionals and over 16 years of experience, the company offers services including advertising stands, UV printing, metal processing, laser pipe cutting, and auto wrapping. The business operates production facilities in Ropaži and Riga, targeting businesses seeking innovative and quality advertising solutions. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to its target audience. Technically, the website is built on the Mozello CMS platform, leveraging Amazon Cloudfront CDN for content delivery. It employs common web technologies such as jQuery and Fancybox, and integrates marketing and analytics tools including Google Analytics, Google Tag Manager, and Facebook Pixel with cookie consent mechanisms. The site is mobile optimized and demonstrates good SEO practices, although some accessibility features could be improved. Security posture is solid with HTTPS enforced, but lacks visible security headers and explicit security policies. From a security and compliance perspective, the site includes privacy and cookie policies with GDPR compliance indicators and consent management. However, no explicit contact information or incident response channels are provided, and WHOIS data could not be retrieved due to query limits, limiting domain trust verification. No vulnerabilities or security issues were detected in the visible content. Overall, the site is safe, professional, and trustworthy, serving a legitimate business in the manufacturing and advertising sector. The overall risk assessment is moderate with recommendations to enhance security headers, provide clearer contact and security policies, and maintain up-to-date third-party libraries. These improvements would strengthen trust and compliance posture, supporting the company’s market position and digital maturity.

20
25
2
75
75
80
100
advertisingmanufacturingcreativelatviamozello+1 more
jQuery 2.2.4Fancybox 3Google Tag ManagerGoogle Analytics (gtag.js)+3
2025-07-30T16:00:20.234Z
aizmakslasskola.lv favicon

Aizkraukles Mākslas skola

aizmakslasskola.lv

42
EducationLatviasmallHIGH

Aizkraukles Mākslas skola is a small educational institution based in Latvia, specializing in art education. The website provides comprehensive information about the school’s offerings, including classes, projects, news updates, and contact details. The target audience primarily consists of students and parents interested in art education within the Aizkraukle region. The school maintains a consistent brand presence and regularly updates news content, indicating active engagement with its community. Technically, the website employs common web technologies such as jQuery, Bootstrap, and Owl Carousel, with Google Tag Manager for analytics. The site is moderately optimized for mobile devices and offers a good user experience with clear navigation and relevant content. However, there is room for improvement in accessibility and SEO optimization. From a security perspective, HTTPS is implied but security headers are not detected in the provided data, and no explicit privacy or cookie policies are present, which may raise compliance concerns under GDPR. The absence of WHOIS data limits the ability to fully verify domain legitimacy, though the website content aligns with a legitimate educational institution. Overall, the site demonstrates a moderate security posture with opportunities for enhancement. The overall risk assessment is moderate, with recommendations focusing on improving privacy compliance, implementing security headers, and enhancing transparency through vulnerability disclosure and incident response information. These steps will strengthen trust and security culture while ensuring regulatory adherence.

20
10
17
60
62
75
20
educationartschoollatvialocalschoolnews+1 more
jQuery 2.2.4Bootstrap 3.xjQuery UIOwl Carousel+1
2025-07-30T16:00:20.026Z