Skip to main content

United Kingdom security reports

Browse 6,690 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

156127
Websites
130
Industries
113
Countries
52
Avg Score
Page 41 of 134|Showing 2001-2050 of 6690
express-exports.co.uk favicon

Express Export Services

express-exports.co.uk

52
TransportationUnited KingdomsmallMEDIUM

Express Export Services Limited is a UK-based international shipping and logistics company with over 50 years of experience. The company offers a broad range of services including parcel delivery, pallet and crate shipping, container shipping, vehicle shipping, international removals, antiques and artwork shipping, oversized cargo handling, professional packing, and customs/documentation assistance. Their target audience includes individuals, families, and businesses requiring reliable and secure international shipping solutions. The website presents a professional and consistent brand image with clear navigation and comprehensive service descriptions. Technically, the website employs modern frontend technologies such as Bootstrap, jQuery, and Owl Carousel, ensuring good mobile responsiveness and user experience. The site uses Google reCAPTCHA to protect forms from spam. However, there is no evidence of advanced security headers or cookie consent mechanisms, which are important for GDPR compliance and security hardening. From a security perspective, the website is accessible without WAF or blocking mechanisms, but lacks several security best practices such as security headers and explicit incident response contacts. The WHOIS data for the domain is unavailable due to a domain registration error indicating the domain name contains too many parts and cannot be registered, which raises concerns about domain legitimacy and ownership consistency. Overall, the website is professional and functional with good content quality and business credibility. However, the domain registration anomaly and missing security headers reduce the overall trust score. Strategic improvements in domain registration verification, security header implementation, and privacy compliance are recommended to enhance trust and security posture.

27
70
60
100
2
35
53
internationalshippingfreightforwardinglogisticsparceldeliveryvehicleshipping+2 more
BootstrapjQueryjQuery bxSliderOwl Carousel+4
2026-07-04T07:19:50.891Z
mrkservices.co.uk favicon

MRK Services

mrkservices.co.uk

62
ManufacturingUnited KingdomsmallMEDIUM

MRK Services is a small, family-run UK business specializing in powder coating, blast cleaning, automotive restoration, and garden furniture restoration services. Established in 1990, the company emphasizes quality, service, and experience, targeting both consumer and business clients seeking surface preparation and restoration solutions. The website reflects a professional and consistent brand image with clear service offerings and customer testimonials, positioning MRK Services as a trusted local specialist in their industry. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA Enterprise for security and analytics. The site is mobile-optimized with good navigation and SEO practices, though some accessibility features could be enhanced. Performance is moderate, with room for optimization. Security posture is solid with HTTPS enforced and anti-bot measures in place, but lacks explicit security headers such as CSP and X-Frame-Options. Privacy compliance is partial; a cookie consent banner is present, but no explicit privacy policy or terms of service pages were detected in the provided content. Contact information is clearly presented, enhancing business credibility. Overall, the website is trustworthy and professional, but domain registration details are unavailable due to WHOIS query issues, which slightly impacts trust assessment. Strategic improvements in privacy documentation and security headers would strengthen compliance and security posture.

60
100
70
39
17
45
83
powdercoatingblastcleaningautomotiverestorationgardenfurniturerestorationfamilybusiness+2 more
HubSpot CMSGoogle AnalyticsGoogle Tag ManagerreCAPTCHA Enterprise+1
2026-07-04T07:18:36.948Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
rjevansroofing.com favicon

RJ Evans Flat Roofing Limited

rjevansroofing.com

52
Real EstateUnited KingdommediumMEDIUM

RJ Evans Flat Roofing Limited is a UK-based commercial roofing contractor specializing in engineered roofing systems for commercial and industrial buildings nationwide. The company offers a comprehensive range of services including installation, repair, inspection, and maintenance of flat and low-slope roofing systems tailored to meet UK regulatory and environmental demands. Their market position is strong, supported by multiple industry accreditations and positive customer testimonials, targeting commercial property owners and facilities managers across the UK. Technically, the website employs modern web technologies such as Google Analytics, Bootstrap, and hCaptcha, indicating a moderate to advanced digital maturity. The site is well-structured, mobile-optimized, and SEO-friendly, though some improvements in accessibility and security headers could enhance its technical posture. From a security perspective, the site benefits from HTTPS and form protection via hCaptcha, alongside cookie consent mechanisms supporting GDPR compliance. However, the absence of visible security headers and lack of explicit incident response or security policy pages suggest areas for improvement. The missing WHOIS data introduces some uncertainty regarding domain registration legitimacy, though the website content and trust signals mitigate this concern. Overall, RJ Evans presents a professional and trustworthy online presence with solid business credibility and technical implementation. Strategic enhancements in security practices and domain registration transparency would further strengthen their security posture and trustworthiness.

57
60
-
85
68
40
25
commercialroofingflatroofingroofingcontractorwaterproofingukroofing+2 more
Google AnalyticsGoogle Tag ManagerhCaptchajQuery+3
2026-07-04T07:17:54.656Z
agencyspace.co.uk favicon

Agencyspace

agencyspace.co.uk

43
MediaUnited KingdomsmallHIGH

Agencyspace is a well-established independent global creative company specializing in advertising, content creation, and experiential marketing. The company positions itself as a forward-thinking agency that helps brands go beyond conventional marketing approaches to become distinctive and memorable. The website reflects a professional and consistent brand image with clear messaging targeted at ambitious brands seeking innovative marketing solutions. The company operates primarily in the media sector and is based in the United Kingdom, with a domain age indicating a mature business presence since 2003. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and integrates Google Analytics and Tag Manager for tracking. The site demonstrates good mobile optimization, SEO practices, and moderate performance. However, some accessibility features could be improved. Security-wise, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the security posture is adequate but could be enhanced by implementing security headers, cookie consent, and incident response information. The business credibility is high due to clear contact information, professional design, and consistent branding. There are no indications of malicious or adult content, making the site safe for general audiences. The domain registration data supports the legitimacy of the business with consistent and transparent WHOIS information. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, publishing security and incident response policies, and maintaining regular updates to WordPress and plugins to mitigate vulnerabilities.

70
47
75
-
15
2
53
creativeagencyadvertisingbrandingmediamarketing+1 more
WordPress 7.0Yoast SEO pluginjQueryGoogle Analytics+4
2026-07-04T07:17:49.347Z
edmonds-accountancy.co.uk favicon

Edmonds Accountancy Ltd.

edmonds-accountancy.co.uk

48
FinanceUnited KingdomsmallHIGH

Edmonds Accountancy Ltd. is a professional accountancy firm based in Reading, Berkshire, UK, offering a wide range of accounting and business advisory services tailored to both businesses and individuals. The company emphasizes client support, transparency with no hidden fees, and expertise in areas such as VAT returns, payroll, self-assessments, and cloud accounting. Their market position is that of a local, approachable, and trusted accounting partner with a strong focus on client relationships and business growth support. Technically, the website is built on WordPress and leverages modern web technologies including jQuery, Gravity Forms for data collection, Google Analytics, Google Tag Manager, Microsoft Clarity, Facebook Pixel for tracking, and Google reCAPTCHA v3 for form security. The site is mobile-optimized, accessible, and SEO-friendly, with a professional design and clear navigation. From a security perspective, the website enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security headers such as Content-Security-Policy and X-Frame-Options, which could enhance protection. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. The main concern is the failure to retrieve WHOIS data due to domain naming rules issues, which limits verification of domain legitimacy. Strategic recommendations include improving security headers, verifying domain registration status, and publishing a security policy to enhance trust and compliance.

57
20
70
60
15
17
68
accountancyaccountantsbusinessadvicefinancereading+5 more
jQueryGravity FormsGoogle AnalyticsGoogle Tag Manager+3
2026-07-04T07:16:51.457Z
noticeboardtv.com favicon

NoticeBoardTv Ltd

noticeboardtv.com

44
HealthcareUnited KingdomsmallHIGH

NoticeBoardTv Ltd is a UK-based company specializing in providing professional waiting room information screen solutions primarily for healthcare providers such as GP surgeries, dentists, hospitals, clinics, pharmacies, and veterinary practices. Established since 2006, the company offers a SaaS model combining hardware control boxes with pre-loaded software and a user-friendly control panel for live content updates, including YouTube integration and content libraries. Their market position is niche and focused on improving patient experience by reducing perceived wait times through engaging digital signage. Technically, the website employs modern web technologies including HTML5, CSS3, Bootstrap, jQuery, and popular JavaScript libraries for sliders and carousels. It integrates Google Analytics and CANDDi for visitor tracking and marketing insights. The site is mobile responsive with good SEO and basic accessibility features, though some improvements could be made in security headers and cookie consent mechanisms. From a security perspective, the site uses HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks explicit security policies, incident response contacts, and cookie consent banners, which are important for GDPR compliance. The WHOIS data is missing or indicates the domain may not be properly registered, which raises concerns about domain legitimacy despite the professional appearance of the site. Overall, the website presents a professional and trustworthy front for a small healthcare technology business, but the absence of WHOIS data and some privacy compliance features suggest areas for improvement. Strategic recommendations include enhancing security headers, implementing cookie consent, clarifying domain registration, and adding security and incident response policies to strengthen trust and compliance.

70
85
-
47
53
2
15
healthcareinformationscreenswaitingroomukgpsurgeries+2 more
HTML5CSS3JavaScriptjQuery+6

Partner Domains:

www.nbtv.co.uk
partner
2026-07-04T07:16:35.696Z
ambassadorfs.com favicon

Ambassador Fire & Security

ambassadorfs.com

54
OtherUnited KingdomsmallMEDIUM

Ambassador Fire & Security is a UK-based company specializing in comprehensive compliance solutions including fire protection, security, and electrical services. Their service portfolio covers fire risk assessments, alarm systems, extinguishers, suppression, training, electrical installations, and more, serving businesses, organizations, and homes across the United Kingdom. The company positions itself as a trusted regional provider with multiple industry certifications such as NSI, SSAIB, and BAFE, enhancing its credibility in the fire and security sector. Technically, the website is built on WordPress using the Elementor and Elementor Pro frameworks, leveraging modern web technologies including jQuery and Font Awesome. The site is mobile-optimized with good design quality and user experience, although SEO and accessibility features are basic. The absence of analytics scripts suggests minimal user tracking, aligning with privacy-conscious practices. From a security perspective, the site enforces HTTPS and implements a cookie consent mechanism with granular controls, indicating GDPR awareness. However, the lack of visible security headers and absence of a privacy policy page represent gaps in compliance and security best practices. The WHOIS data is missing or unavailable, which raises concerns about domain registration transparency despite the professional appearance and certifications displayed. Overall, the website demonstrates a solid business presence with good technical implementation but requires improvements in privacy documentation, security headers, and domain registration transparency to enhance trust and compliance.

100
75
15
2
65
60
37
firesafetysecuritycomplianceelectricalservicesuk+1 more
jQuery 3.7.1jQuery Migrate 3.4.1Elementor 4.1.4Elementor Pro 4.1.2+4
2026-07-04T07:16:09.370Z
C

Chiltern Solicitors

chilternsolicitors.co.uk

37
OtherUnited KingdomsmallHIGH

Chiltern Solicitors is a small legal services firm based in Luton, UK, providing solicitor services. Their website is currently under construction and primarily serves as a contact point with basic company information including physical address, phone number, and email contacts. The business targets individuals and businesses seeking legal advice locally. The website lacks comprehensive content and does not yet provide detailed service descriptions or client resources. Technically, the website uses older JavaScript libraries such as jQuery 1.8.3 and RequireJS, with no detected CMS or modern frameworks. The site shows basic mobile optimization but lacks advanced SEO and accessibility features. There is no evidence of HTTPS enforcement or security headers, which indicates a weak security posture. The WHOIS data for the domain is unavailable due to a domain naming error, raising concerns about domain registration legitimacy. Security-wise, the site has minimal protections in place, no privacy or cookie policies, and no incident response or vulnerability disclosure information. The lack of HTTPS and outdated libraries present vulnerabilities. Overall, the site is low risk in terms of content safety but requires significant improvements in security and compliance to meet professional standards. Recommendations include implementing HTTPS, updating technical components, adding privacy and cookie policies, improving accessibility and SEO, and resolving domain registration issues to enhance trust and security.

47
20
65
55
50
15
2
legalsolicitorslawcontactunderconstruction
JavaScriptRequireJSjQuery 1.8.3
2026-07-04T07:15:27.293Z
S

Sampling International Enterprises Ltd

samplingint.co.uk

56
ManufacturingUnited KingdommediumMEDIUM

Sampling International Enterprises Ltd is a UK-based manufacturing company specializing in bespoke sampling and display solutions primarily for the textile industry. With over 45 years of experience, the company offers a wide range of products including sample books, shade cards, fabric swatch books, and consumer sample fulfilment services. Their market position is strong within the UK, serving manufacturers and major retailers with a reputation for quality and innovation. The website reflects a professional business model focused on manufacturing and fulfilment with an in-house design studio to support client needs. Technically, the website is built on WordPress using Elementor, enhanced with modern tools such as Google Analytics, Google Tag Manager, and reCAPTCHA v3 for security. The site is hosted by Zen Internet Limited, a reputable UK hosting provider. Performance and mobile optimization are good, with SEO and accessibility at a basic to good level. Security best practices are observed, including HTTPS enforcement, security headers, and cookie consent mechanisms, although explicit security and incident response policies are not publicly available. The security posture is solid with no detected vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including GDPR compliance indicators. Contact information is comprehensive and easily accessible, enhancing business credibility. Overall, the website is trustworthy, professional, and well-maintained, supporting the company’s market position. Strategically, the company should consider publishing explicit security policies and incident response contacts to further enhance trust and compliance. Regular audits of third-party scripts and improvements in accessibility would also benefit the site’s security and user experience.

42
70
60
100
15
53
25
manufacturingsamplingtextiledisplaysolutionsfulfilment+2 more
WordPressElementorEWWW Image OptimizerGoogle Analytics+2
2026-07-04T07:15:21.987Z
compositesevolution.com favicon

Composites Evolution

compositesevolution.com

45
ManufacturingUnited KingdomsmallHIGH

Composites Evolution is a UK-based small manufacturing business specializing in the production and supply of prepreg composite materials. Established in 2009, the company positions itself as a niche supplier within the composites industry, targeting business customers and professionals requiring advanced composite solutions. The website prominently features partnerships such as with Simcas Composites, indicating a collaborative business model focused on product availability and distribution. Technically, the website is built on WordPress using modern frameworks and plugins including Divi Builder and Yoast SEO, supported by common libraries like jQuery and Bootstrap. The site demonstrates good mobile optimization and SEO practices but lacks some advanced accessibility features. Security posture is moderate with HTTPS enabled and domain transfer protections in place, but lacks DNSSEC and explicit security headers. Privacy compliance is weak due to absence of privacy and cookie policies or consent mechanisms. Overall, the domain registration data is consistent with the business claims, enhancing credibility. Strategic improvements in privacy compliance and security hardening are recommended to elevate trust and compliance.

37
75
70
40
15
17
35
compositesprepregmanufacturingb2bindustrial
jQueryBootstrap 4.6Yoast SEO pluginDivi Builder plugin+4

Partner Domains:

simcascomposites.com
partner
2026-07-04T07:15:16.719Z
rocksolidknowledge.com favicon

Rock Solid Knowledge

rocksolidknowledge.com

75
TechnologyUnited KingdomsmallMEDIUM

Rock Solid Knowledge is a UK-based technology company specializing in secure Umbraco CMS, web, and mobile development services. Established since 2009, the company positions itself as a trusted partner delivering scalable, ethical, and sustainable digital solutions. They hold multiple certifications including Certified B Corporation™, Umbraco Gold Partner status, and Cyber Essentials Certified Plus, underscoring their commitment to quality and security. Their client base includes notable organizations across various sectors, reflecting a strong market presence. Technically, the website leverages modern frameworks such as Umbraco CMS, IdentityServer, and OpenIddict, supported by Alpine.js and HubSpot analytics. The site is well-optimized for mobile and accessibility, with a professional design and clear navigation. Security practices include HTTPS enforcement and cookie consent mechanisms, although explicit security headers are not evident in the provided data. The security posture is strong with ongoing maintenance and updates emphasized, but the absence of a published security policy or incident response contact is a gap. WHOIS data is unavailable, which raises some concerns about domain registration transparency, but the website's trust signals and certifications mitigate this risk. Overall, Rock Solid Knowledge presents a mature, professional digital presence with a solid security foundation and ethical business practices. Strategic improvements in security policy transparency and WHOIS data clarity would enhance trust further.

72
100
80
80
83
25
75
webdevelopmentumbracomobiledevelopmentsecurityidentityserver+5 more
Umbraco CMSIdentityServerOpenIddictGoogle Tag Manager+2

Partner Domains:

www.identityserver.com
partner
www.openiddictcomponents.com
partner
2026-07-04T07:15:06.114Z
E

Euro Drive Systems Ltd

eurodrivesystems.com

44
ManufacturingUnited KingdomsmallHIGH

Euro Drive Systems Ltd is a UK-based supplier specializing in industrial electric motors, compact gear motors, frequency inverters, and power transmission components. The company operates from two UK depots, offering competitive pricing, warranty, and technical support, with a focus on next-day delivery for most products. They hold exclusive distribution agreements with several manufacturers, positioning themselves as a trusted supplier in the manufacturing sector. Technically, the website uses standard web technologies including jQuery and Font Awesome, with a basic but functional design. The site is accessible over HTTPS, though it lacks advanced security headers and privacy policies. Mobile optimization and accessibility are basic, and no analytics or tracking scripts were detected, indicating a minimal data collection approach. From a security perspective, the site has a moderate posture with HTTPS enabled but missing key security headers and privacy compliance documentation. The absence of WHOIS registration data raises concerns about domain legitimacy, which impacts overall trust. No forms or email addresses are present, reducing attack surface but also limiting user engagement channels. Overall, the website is professional and business-focused but would benefit from improved security practices, privacy compliance, and domain registration transparency to enhance trust and reduce risk.

60
47
85
20
50
2
20
industrialmotorsgearmotorsfrequencyinverterspowertransmissionmanufacturing+1 more
jQueryFont AwesomeCSS3HTML5
2026-07-04T07:14:55.575Z
jaderecruitment.net favicon

Jade Recruitment

jaderecruitment.net

46
OtherUnited KingdomsmallHIGH

Jade Recruitment Ltd is a well-established recruitment agency operating primarily in Surrey and Hampshire, UK, since 1987. The company specializes in matching candidates with temporary and permanent job opportunities across commercial, catering, care, and industrial sectors. They also provide HR consultancy services to employers lacking in-house HR teams. The website reflects a professional business with clear service offerings, a focus on local recruitment, and a strong emphasis on personalized candidate-employer matching. Their market position is that of a trusted local agency with longstanding client relationships. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WP Job Manager, and Slider Revolution. It employs Google Analytics for visitor tracking and is optimized for mobile devices with good SEO practices. Performance is moderate, with room for improvement in accessibility and security headers. The site uses HTTPS with a valid SSL certificate, ensuring secure communications. From a security perspective, the site demonstrates basic good practices such as HTTPS enforcement and no visible sensitive data exposure. However, it lacks advanced security headers and a published incident response or vulnerability disclosure policy. Privacy compliance is partially addressed with privacy and cookie policies present, though no explicit cookie consent mechanism is implemented. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, which should be further investigated. Overall, Jade Recruitment presents a credible and professional online presence with a solid business foundation. Strategic improvements in security posture, privacy compliance, and domain registration transparency would enhance trust and reduce risk exposure.

57
75
55
-
15
2
85
recruitmentjobshrconsultancysurreyhampshire+2 more
WordPressPHPjQueryGoogle Analytics+3
2026-07-04T07:14:08.261Z
M

Matrix Precision Engineering Ltd

matrixprecision.com

48
ManufacturingUnited KingdomsmallHIGH

Matrix Precision Engineering Ltd is a UK-based precision manufacturing company specializing in a wide range of machining and engineering services including CNC milling, 5-axis machining, mill/turn machining, EDM machining, and project management. The company has been established since 2004 and targets industrial clients requiring high precision engineering solutions. The website is built on WordPress using a standard theme and provides navigation to detailed service pages, although the homepage content is minimal. From a technical perspective, the website uses HTTPS and is hosted likely via GoDaddy based on nameservers. The site shows moderate performance and basic mobile optimization. However, it lacks advanced security headers and DNSSEC is not enabled, which could be improved to enhance security posture. No privacy or cookie policies are present, indicating gaps in compliance with data protection regulations. Security posture is moderate with HTTPS enabled but missing several best practices such as security headers and incident response information. No vulnerabilities or malware were detected in the content. The domain registration is consistent with the business profile, showing a long-standing presence since 2004, registered with a reputable registrar. Overall, the website is functional but could benefit from improved privacy compliance and security hardening. Recommendations include implementing privacy and cookie policies, enabling DNSSEC, adding security headers, and providing clear contact information to improve trust and compliance. Enhancing technical SEO and content richness would also improve user experience and business credibility.

37
40
70
90
15
17
50
manufacturingprecisionengineeringcncmachiningindustrialservicesengineeringservices
WordPressPHPJavaScript
2026-07-04T07:13:47.216Z
W

Will Writing and Probate Services Ltd.

wtponline.co.uk

56
OtherUnited KingdomsmallMEDIUM

Will Writing and Probate Services Ltd. is a small UK-based company specializing in legal services related to wills, probate, powers of attorney, and property trusts. With over 25 years of experience, the company targets individuals in the Bristol, Gloucester, and Wiltshire areas seeking professional assistance in estate planning and related legal matters. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to its audience. Technically, the website uses JavaScript and Google Analytics for tracking, and is built on the itseeze CMS platform. The site is mobile-optimized and demonstrates good SEO practices, although some accessibility features could be improved. Performance is moderate, with no major technical issues detected in the HTML content. From a security perspective, the site uses HTTPS and implements a cookie consent mechanism, but lacks visible security headers and explicit security policies. No vulnerabilities or exposed sensitive data were found in the content. However, the WHOIS lookup failed due to domain registration errors, which raises concerns about domain legitimacy and trustworthiness despite the professional website content. Overall, the website presents a trustworthy and professional front for its business, but the domain registration anomaly should be investigated further. Enhancing security headers and publishing clear security and incident response policies would improve the security posture and compliance standing.

42
30
70
100
60
2
68
willwritingprobateserviceslegalservicesukwills+2 more
JavaScriptGoogle Analytics (gtag.js)Responsive design scripts
2026-07-04T07:13:41.954Z
blumin.co.uk favicon

Blumin

blumin.co.uk

61
TechnologyUnited KingdommediumMEDIUM

Blumin is an award-winning full service design agency operating primarily in Cornwall, Manchester, and Cheshire, UK. They specialize in branding, website design and development, bespoke web software, and marketing strategies aimed at launching, growing, and transforming businesses. Their market position is strong regionally with a focus on integrating brand and digital services to deliver comprehensive solutions. The website is professionally designed with excellent content quality and clear navigation, targeting business clients seeking digital and branding services. Technically, the website leverages modern web technologies including Webflow CMS, Google Tag Manager, Microsoft Clarity, LinkedIn Insight Tag, and Sentry for error monitoring. The site is hosted on Webflow's CDN, ensuring fast performance and mobile optimization. Privacy compliance is well addressed with a cookie consent mechanism and a comprehensive privacy policy. However, explicit security headers are not detected in the HTML, which could be improved. Security posture is good with HTTPS enforced and no exposed sensitive data, but the absence of security headers and incident response information suggests room for enhancement. The WHOIS lookup failed due to a domain registration error indicating the domain name contravenes Nominet UK naming rules, which is unusual and reduces trust slightly. Despite this, the website content and business information appear legitimate and professional. Overall, the website presents a low risk with strong business credibility and technical maturity. Strategic recommendations include implementing security headers, publishing incident response and security policies, and resolving domain registration inconsistencies to enhance trust and compliance.

65
44
100
85
83
30
2
brandingwebdesignsoftwaredevelopmentmarketingstrategiesdigitaltransformation+3 more
WebflowjQueryGoogle Tag ManagerMicrosoft Clarity+4
2026-07-04T07:13:10.410Z
odesa.co.uk favicon

Odesa Limited

odesa.co.uk

54
OtherUnited KingdomsmallMEDIUM

Odesa Limited is a well-established professional cleaning company based in Southwest London, with over 20 years of experience. The company specializes in cleaning services across multiple sectors including offices, schools, retail, and communal areas. Their market position is that of a trusted local expert with a strong client retention rate, supported by recognized certifications such as ISO 14001 and OHSAS 18001. The website reflects a professional business model focused on service delivery to local institutions and businesses. Technically, the website is built on WordPress and employs modern web technologies including Google reCAPTCHA for form security and ShortPixel for image optimization. Hosting is provided by Krystal Hosting Ltd, a reputable UK-based provider. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with room for improvement in loading speed and accessibility. From a security perspective, the site enforces HTTPS and includes a Content-Security-Policy header, which are positive indicators. However, additional security headers are missing, and there is no visible formal security or incident response policy. The absence of a cookie consent mechanism suggests partial GDPR compliance. No vulnerabilities or exposed sensitive data were detected, indicating a generally sound security posture. Overall, the website is professional, trustworthy, and well-aligned with the company's business claims. Strategic improvements in privacy compliance and security policy transparency would enhance the site's risk profile and user trust.

62
60
85
20
55
17
53
cleaningprofessionalserviceslondonofficecleaningretailcleaning+1 more
WordPressPHPjQueryGoogle reCAPTCHA+2
2026-07-04T07:12:59.884Z
P

Prestige Roofing Ltd

prestige-roofing.co.uk

35
Real EstateUnited KingdomsmallHIGH

Prestige Roofing Ltd is a well-established roofing company based in London, providing residential and commercial roofing services including new roof installations, re-roofing, emergency repairs, and cladding installation. The company has over 40 years of experience and holds reputable certifications such as Which? Trusted Trader and membership in the Guild of Master Craftsmen, positioning it as a trusted service provider in its market segment. The website reflects a professional business with clear service offerings and customer testimonials supporting its credibility. Technically, the website is built on WordPress with a modern tech stack including popular plugins for analytics, forms, and sliders. It uses HTTPS and has moderate performance and good mobile optimization. However, some security best practices such as security headers and cookie consent mechanisms are missing, which could be improved to enhance compliance and security posture. Security-wise, the site shows no immediate vulnerabilities or exposed sensitive data, but the absence of security headers and incident response information indicates room for improvement. The WHOIS data is unavailable due to domain naming rules errors, which limits domain trust verification, but the website content and certifications provide compensating trust signals. Overall, the website is professional and trustworthy with moderate technical maturity and a good security baseline. Strategic improvements in privacy compliance and security hardening are recommended to further strengthen the company's digital presence and trustworthiness.

40
60
-
52
15
2
35
roofingconstructionservicesuktrustedtrader+2 more
WordPress 5.7.15PHPjQuery 3.5.1Revolution Slider 5.4.1+5
2026-07-04T07:12:49.391Z