Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149319
Websites
130
Industries
113
Countries
52
Avg Score
Page 973 of 1022|Showing 48601-48650 of 51093
ibo.org favicon

International Baccalaureate Organization

ibo.org

57
EducationN/alargeMEDIUM

The International Baccalaureate Organization (IBO) is a globally recognized non-profit entity providing high-quality international education programs to over 1.9 million students across more than 5,800 schools worldwide. The website reflects a strong market position with comprehensive educational offerings, professional development services, and a robust global community. The content is well-structured, professionally designed, and highly relevant to its target audience of students, educators, and educational institutions. Technically, the website employs modern web technologies including JavaScript, jQuery, Google Tag Manager, and Cookiebot for privacy compliance. The use of Chakra UI framework enhances the user interface and accessibility. Hosting appears to be via Cloudflare, ensuring good performance and security. The site is mobile-optimized and includes accessibility features, contributing to a positive user experience. From a security perspective, the site enforces HTTPS, implements multiple security headers, and uses a comprehensive cookie consent mechanism with granular controls. No critical vulnerabilities or exposed sensitive data were detected. However, explicit security policies and incident response information are not publicly available, representing an area for improvement. Overall, the website demonstrates a mature digital presence with strong privacy and compliance practices, extensive analytics and marketing integrations, and a high level of professionalism. The risk profile is low, but strategic enhancements in security transparency and vulnerability disclosure could further strengthen trust and compliance.

55
63
-
70
-
80
100
educationinternationalbaccalaureateprofessionaldevelopmentinternationaleducationstudentprograms+3 more
JavaScriptjQueryGoogle Tag ManagerGoogle Analytics+3
2025-06-15T22:26:22.562Z
wmf.com favicon

Groupe SEB WMF Retail GmbH

wmf.com

63
RetailGermanylargeHIGH

WMF Onlineshop is the official e-commerce platform of Groupe SEB WMF Retail GmbH, a historic German company with over 170 years of tradition in premium kitchenware and coffee machines. The website offers a comprehensive product catalog, including cutlery, pots, pans, coffee machines, and kitchen accessories, targeting consumers seeking high-quality kitchen products. The platform integrates modern technologies such as Magento 2 with Hyvä Theme, Alpine.js, and various marketing and analytics tools, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and employs monitoring tools like New Relic. It also implements robust privacy and cookie consent mechanisms via OneTrust, ensuring GDPR compliance. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not visibly configured, representing an area for improvement. No critical vulnerabilities or WAF blocking were detected, indicating a secure and accessible platform. Overall, WMF Onlineshop demonstrates a high level of professionalism, technical sophistication, and compliance with privacy regulations. It effectively balances user experience, security, and business needs, positioning itself as a trustworthy and reputable online retailer in the premium kitchenware market.

85
63
-
85
-
85
100
e-commerceretailkitchenwareprivacycookieconsent+3 more
JavaScriptAlpine.jsGlider.jsGoogle Tag Manager+4

Partner Domains:

aboutwmf.com
partner
www.schaerer.com
partner

+3 more partners

2025-06-15T22:26:22.465Z
consys.it favicon

Consys.it Srl

consys.it

52
TechnologyItalymediumMEDIUM

Consys.it Srl is an Italian cybersecurity company specializing in managed security services, compliance solutions, and advanced cybersecurity technologies. The company positions itself as a trusted partner for businesses seeking to protect their digital assets and comply with stringent regulatory requirements. Their website presents a professional and consistent brand image, targeting B2B clients with a comprehensive portfolio of cybersecurity services including Security Operation Center, Security Automation, and Compliance Guard solutions. The technical infrastructure is based on WordPress CMS with modern plugins and integrations such as WPBakery Page Builder, Contact Form 7, Google Tag Manager, and Google reCAPTCHA, indicating a mature digital presence. The site is mobile optimized and includes privacy compliance mechanisms via Iubenda, reflecting attention to GDPR requirements. Security posture is strong with HTTPS enforced, use of reCAPTCHA on forms, and cookie consent management. However, explicit security headers and incident response contact details are not evident, suggesting areas for improvement. The WHOIS data aligns well with the website's business claims, supporting legitimacy and trustworthiness. Overall, Consys.it demonstrates a solid cybersecurity business presence with good technical and privacy compliance, though enhancements in security transparency and incident response communication would strengthen their posture further.

15
43
40
70
-
65
100
cybersecuritymanagedsecuritycomplianceitsecurityb2bservices+2 more
WordPressWPBakery Page BuilderContact Form 7Google Tag Manager+5

Partner Domains:

advens.fr
partner
cyberguru.it
partner

+3 more partners

2025-06-15T22:26:09.632Z
tipico-careers.com favicon

Tipico Careers

tipico-careers.com

54
TechnologyGermanylargeMEDIUM

Tipico Careers is the official recruitment portal for Tipico, a leading sports betting provider in Germany and a recognized technology company in the gaming industry. The website serves as a comprehensive platform for job seekers, showcasing open roles, company culture, and benefits. The business positions itself strongly in the sports betting market with a focus on innovation, teamwork, and excellence. The site targets professionals interested in careers within sports betting and technology sectors, emphasizing a vibrant and inclusive work culture. Technically, the website employs modern web technologies including jQuery, Popper.js, Google Tag Manager, Microsoft Clarity, Hotjar, and Crazy Egg for analytics and user experience optimization. The site is mobile-optimized, accessible, and SEO-friendly with proper meta tags and structured data. Performance is moderate with multimedia content and video integration. From a security perspective, the site uses HTTPS and implements cookie consent mechanisms aligned with GDPR. However, explicit security headers and published security policies are absent, representing an area for improvement. No vulnerabilities or exposed sensitive data were detected. The domain registration details are consistent with the business claims, enhancing trustworthiness. Overall, the website is professional, secure, and compliant with privacy regulations, making it a reliable platform for prospective employees. Strategic recommendations include enhancing security headers, publishing incident response contacts, and adding vulnerability disclosure information to further strengthen security posture and trust.

70
53
25
60
-
75
100
careerssportsbettingtechnologyjobsrecruitment+4 more
jQuery 3.5.1Popper.js 1.16.0Google Tag ManagerMicrosoft Clarity+3

Partner Domains:

sports.tipico.de
partner
sports.tipico.com
partner

+2 more partners

2025-06-15T22:25:07.557Z
bandex.com favicon

BANDEX

bandex.com

8
ManufacturingAustriamediumMINIMAL

BANDEX is a well-established Austrian manufacturing company specializing in curtain and decorative bands, with a history dating back to 1955. The company offers a range of textile products including curtain tapes and technical textiles, supported by an online shop and innovative digital tools such as configurators and a virtual showroom. Their target audience includes retail customers, interior decorators, and textile professionals. The website is primarily in German and reflects a medium-sized enterprise with consistent branding and a good level of content quality. Technically, the website employs a modern tech stack including jQuery, Bootstrap, and Google Tag Manager, with additional tools for user interaction and tracking. The site is mobile-optimized and provides a good user experience with clear navigation and structured content. However, some technical details such as hosting provider and CMS are not explicitly identified. From a security perspective, the site uses HTTPS and implements a cookie consent mechanism compliant with GDPR. While no explicit security policies or incident response contacts are found, the site does not exhibit obvious vulnerabilities or exposed sensitive data. The use of third-party tracking services is moderate, and privacy compliance appears adequate. Security headers and advanced security practices could be improved. Overall, BANDEX presents a trustworthy and professional online presence with moderate risk. Strategic improvements in security policy transparency, incident response readiness, and security header implementation would enhance their security posture and compliance standing.

20
53
10
-
47
-
20
jQueryBootstrapGoogle Tag ManagerLeadinfo tracking+2

Partner Domains:

bandex-techtex.com
subsidiary
2025-06-15T22:25:07.173Z
brainloop.com favicon

Brainloop AG

brainloop.com

23
TechnologyGermanymediumLOW

Brainloop AG is a German-based technology company specializing in secure online collaboration and data room solutions for enterprises, particularly targeting DAX-40 companies and corporate governance professionals. Their product suite includes Brainloop MeetingSuite, BoardRoom, DealRoom, and CollaborationRoom, designed to facilitate confidential document handling and secure communication both internally and with external partners. The company positions itself as a leading provider in the DACH region with a strong focus on information security and compliance. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Google Tag Manager, indicating a mature digital infrastructure. The site is mobile-optimized and SEO-friendly, though some accessibility features could be improved. Security-wise, the site enforces HTTPS and respects Do Not Track signals, but lacks explicit security headers and a cookie consent mechanism, which are recommended for enhanced compliance and protection. Overall, the domain registration data aligns well with the company's identity, supporting legitimacy and trust. Strategic recommendations include implementing cookie consent, publishing a security policy, and enhancing security headers to strengthen the security posture further.

25
53
10
-
87
-
100
jQueryWordPressYoast SEOGoogle Tag Manager+4

Partner Domains:

my.brainloop.at
subsidiary
my.brainloop.ch
subsidiary

+1 more partners

2025-06-15T22:25:06.383Z
ableneo.com favicon

Ableneo

ableneo.com

37
TechnologyN/amediumHIGH

Ableneo is a medium-sized technology and transformation partner specializing in bridging business consulting with software engineering to support startups, scaleups, and corporates in driving innovation and growth. The company offers key services including AI & Data enabling, Business Optimization & Efficiency, Product Design & Development, and Software Engineering. With over 80 team members, multiple offices worldwide, and a client base exceeding 50, Ableneo positions itself as a trusted partner in the technology consulting space. Technically, the website is built on WordPress with modern plugins such as Yoast SEO, Contact Form 7, and Complianz GDPR for compliance. The hosting infrastructure appears to be on AWS, and the site uses various frontend technologies including Bootstrap, Swiper.js, and Lottie animations. SEO and mobile optimization are well implemented, though performance metrics indicate slow loading times. From a security perspective, the site lacks a valid SSL certificate and does not support any TLS protocols, which is a critical vulnerability. No advanced security headers or incident response policies are present. However, email authentication via SPF is configured, and no known SSL vulnerabilities like Heartbleed or POODLE are detected. Privacy compliance is strong with GDPR-aligned cookie consent and privacy policies. Overall, the website is professional and content-rich, but the absence of HTTPS significantly impacts its security posture and trustworthiness. Strategic improvements in SSL/TLS deployment and security headers are essential to enhance protection and user confidence.

15
18
5
50
-
85
85
technologyaisoftwareengineeringbusinesstransformationconsulting+2 more
WordPressYoast SEO pluginContact Form 7Complianz GDPR plugin+6
2025-06-15T22:12:50.549Z
nhm.ac.uk favicon

The Natural History Museum

nhm.ac.uk

40
EducationUnited KingdomlargeHIGH

The Natural History Museum website serves as a comprehensive digital portal for one of the UK's leading educational and cultural institutions. It offers extensive information on exhibitions, scientific research, educational resources, and visitor services, targeting a broad audience including the general public, educators, and researchers. The site is well-branded, professionally designed, and provides clear navigation and rich content relevant to its mission. Technically, the website leverages modern web technologies such as React with Next.js and Adobe Experience Manager as its CMS, hosted on Microsoft Azure. While the site is mobile-optimized and accessible, performance is currently hindered by an invalid SSL certificate and lack of enabled TLS protocols, which also impacts the security posture. Security-wise, the site implements some security headers like HSTS and X-Frame-Options but lacks a valid SSL certificate and proper TLS support, which are critical for secure communications. Privacy and cookie policies are comprehensive and GDPR compliant, with a clear consent mechanism in place. Social media integration and tracking tools like Google Tag Manager and Adobe DTM are used responsibly with privacy considerations. Overall, the website is trustworthy and professional but requires urgent remediation of SSL and TLS issues to ensure secure user interactions and improve its security score. Strategic improvements in SSL management and security best practices will enhance user trust and compliance.

45
-
5
50
-
85
100
museumeducationsciencenaturalhistoryuk+1 more
React (Next.js)Adobe Experience Manager (AEM)Google Tag ManagerAdobe DTM (Dynamic Tag Management)+3
2025-06-15T22:12:49.186Z
bernd-gruber.at favicon

Bernd Gruber GmbH

bernd-gruber.at

24
Real EstateAustriasmallCRITICAL

Bernd Gruber GmbH operates as a boutique interior design and craftsmanship firm based in Austria, specializing in high-end interior architecture and handcrafted furniture. The company leverages a rich heritage of 60 years in woodworking combined with 20 years of interior design experience, targeting affluent clients seeking bespoke design solutions. Their business model includes both service delivery through projects and product sales via an online shop. The website reflects a professional and consistent brand image with good content quality and clear navigation, supporting their market positioning as a premium provider in the real estate and hospitality sectors. Technically, the website is built on TYPO3 CMS and hosted on Conova infrastructure, utilizing modern web technologies such as SVG graphics and Google Tag Manager for analytics and marketing. However, the site suffers from a critical security shortfall due to the absence of HTTPS, which severely impacts its security posture. Performance metrics are not optimal, indicating room for improvement in loading speed and technical optimization. Mobile responsiveness and SEO are adequately addressed. Security-wise, the lack of SSL/TLS encryption is a major vulnerability, exposing users to potential data interception risks. While some security headers are present, the overall security configuration is basic and requires urgent enhancement. Privacy compliance is well managed with a comprehensive cookie consent mechanism and clear privacy policy, aligning with GDPR requirements. Contact information is transparent and easily accessible, enhancing business credibility. Overall, the website presents a trustworthy and professional front but must prioritize implementing HTTPS and improving security configurations to protect user data and maintain compliance. Strategic recommendations include securing the site with a valid SSL certificate, enabling modern TLS protocols, and enhancing security headers. These steps will significantly improve the site's security score and user trust, supporting the company's premium market positioning.

30
-
-
50
-
85
20
interiordesignhandwerkinnenarchitekturberndgruberkitzbhel+4 more
TYPO3 CMSnginxGoogle Tag ManagerLinkedIn Insight Tag+1
2025-06-15T22:12:46.327Z
S

Stepan Company

stepan.com

40
ManufacturingUnited StateslargeHIGH

Stepan Company operates as a global specialty and intermediate chemical supplier, providing chemical ingredients and formulations tailored to consumer and industrial markets. The company emphasizes innovation, sustainability, and extensive R&D capabilities, positioning itself as a large, reputable player in the manufacturing sector. Their website reflects a professional and comprehensive digital presence with clear navigation and rich content targeting B2B customers seeking chemical solutions. Technically, the website leverages Adobe Experience Manager as its CMS, integrates Salesforce platforms, and uses modern marketing and analytics tools such as Pardot, Adobe DTM, and Google Tag Manager. The site is hosted on Microsoft Azure DNS infrastructure and employs standard security headers and content security policies. However, a critical security gap exists due to the absence of a valid SSL certificate and HTTPS support, which significantly impacts the site's security posture. From a security perspective, while some best practices like CSP and secure cookies are implemented, the lack of HTTPS and modern TLS protocols exposes the site to risks and undermines user trust. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. Contact information is primarily available via web forms, with no direct emails or phone numbers published. Overall, the site is trustworthy and professionally managed but requires urgent remediation of its SSL/TLS configuration to meet modern security standards and improve user confidence.

55
33
-
50
-
85
100
chemicalmanufacturingspecialtychemicalssustainabilityinnovation+2 more
jQuery 3.7.0Adobe Dynamic Tag ManagerGoogle Tag ManagerPardot marketing automation+3

Partner Domains:

gcs-web.com
partner91
2025-06-15T22:12:25.850Z
auralight.com favicon

Aura Light International AB

auralight.com

40
EnergySwedenlargeHIGH

Aura Light International AB is a well-established company specializing in sustainable and energy-efficient lighting solutions for professional environments such as public spaces, industry, and retail. The company offers a broad range of products including luminaires, light sources, and smart lighting control systems, positioning itself as a leading player in the Nordic and international markets. The website reflects a professional B2B business model with clear product segmentation and customer engagement channels. Technically, the website is built on the Litium e-commerce platform with integrations such as Google Tag Manager and Cookiebot for analytics and privacy compliance. The site is well-structured, mobile-optimized, and SEO-friendly, although performance metrics are not available. Hosting appears to be via Fastly CDN with Varnish caching. From a security perspective, the site lacks a valid SSL/TLS certificate, resulting in no HTTPS support, which is a critical vulnerability impacting user trust and data security. Security headers are partially implemented, but modern TLS protocols are disabled. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms. Contact information is readily available, but no explicit security policy or incident response details are found. Overall, Aura Light's website demonstrates solid business credibility and content quality but requires urgent improvements in SSL/TLS configuration to enhance security posture and user trust. Strategic recommendations include installing a valid SSL certificate, enabling modern TLS protocols, and publishing incident response contacts to strengthen security transparency.

-
-
-
50
-
85
100
lightingenergy-efficientsustainabilityb2bsmartlighting+1 more
Litium e-commerce platformJavaScriptGoogle Tag ManagerCookiebot+2
2025-06-15T22:12:08.199Z
leifheit.com favicon

Leifheit

leifheit.com

38
RetailGermanylargeHIGH

Leifheit is a well-established German retail company specializing in household and kitchen products, with a strong brand presence and a history of over 65 years. The website serves as an e-commerce platform built on Shopware 6, offering a wide range of products including cleaning tools, laundry drying solutions, and kitchen utensils. The site is professionally designed with good navigation, mobile optimization, and rich multimedia content, targeting household consumers seeking quality products. Technically, the site uses modern JavaScript libraries and integrates marketing and analytics tools such as Bazaarvoice, Klaviyo, and Google Tag Manager. However, a critical security gap exists as the website currently lacks a valid SSL/TLS certificate and does not enforce HTTPS, exposing users to potential risks. Security headers are partially implemented, but the absence of HTTPS severely impacts the overall security posture. Privacy and cookie policies are present and include consent mechanisms, indicating compliance with GDPR requirements. Contact information is available via a contact page, though no explicit emails or phone numbers are embedded in the HTML content. The domain registration and DNS records are consistent with the company's German origin and business claims, supporting legitimacy. Strategic recommendations include immediate implementation of HTTPS, enhancement of security policies, and improved incident response readiness to strengthen trust and compliance.

-
15
-
50
-
85
100
e-commercehouseholdcleaningkitchenretail+1 more
Shopware 6Swiper.jsBazaarvoiceCookiebot+4

Partner Domains:

leifheit-group.com
parentpending
e-point.pl
partner96
2025-06-15T22:12:07.254Z
strobl.at favicon

Strobl Bau – Holzbau GmbH

strobl.at

21
Real EstateAustriamediumCRITICAL

Strobl Bau – Holzbau GmbH is a well-established construction and wood construction company based in Austria, with a history dating back to 1964. The company specializes in residential, industrial, and commercial building projects using both massive and wood construction methods. It holds a leading position in the regional market of Steiermark, offering comprehensive services including planning, coordination, and quality control. The website reflects a professional and consistent brand image, targeting property developers and clients seeking high-quality construction solutions. Technically, the website is built on WordPress with a modern tech stack including Apache, jQuery, Bootstrap, and several specialized plugins for enhanced user experience and functionality. However, the site lacks a valid SSL certificate and does not support modern TLS protocols, which significantly impacts its security posture. Despite this, the site implements several security headers and has a good privacy and cookie policy framework with consent mechanisms, indicating a commitment to compliance. The security evaluation reveals critical vulnerabilities due to the absence of HTTPS, lack of strong cipher suites, and incomplete HSTS implementation. These issues pose risks to data confidentiality and user trust. The website provides multiple contact channels, including phone, email, and contact forms, along with active social media profiles, enhancing its business credibility. Overall, while the business and content quality are strong, the security shortcomings require urgent attention to protect users and maintain trust. Strategic improvements in SSL/TLS deployment and security configurations are recommended to elevate the site's security and compliance standards.

-
-
-
50
-
50
-
constructionrealestatewoodconstructionaustriawordpress+3 more
ApachePHPjQueryBootstrap+7
2025-06-15T22:11:18.495Z