Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 6 of 124|Showing 251-300 of 6193
redearthstudio.com favicon

Red Earth Studio Ltd.

redearthstudio.com

55
MediaUnited KingdomsmallMEDIUM

Red Earth Studio Ltd. is a London-based award-winning film and video production company specializing in branded content and documentaries since 2003. The company targets brands and businesses seeking impactful storytelling through film. Their market position is established and reputable within the media production sector, offering full-service production capabilities. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress 6.9.4 with a modern tech stack including jQuery, Google Analytics, and Mailchimp integrations. The site is mobile-optimized and performs moderately well, though accessibility features are basic. SEO is enhanced by Yoast SEO plugin usage. However, no hosting provider or CDN details were identified. Security posture is adequate with HTTPS enabled and no visible sensitive data exposure. However, the absence of security headers and privacy/cookie policies indicates room for improvement in compliance and security best practices. The WHOIS data is missing, which raises concerns about domain registration transparency, although the website content and business information appear legitimate. Overall, the website is professional and trustworthy but would benefit from enhanced privacy compliance, security headers, and WHOIS transparency to improve trust and security posture.

25
35
2
70
52
85
100
filmvideoproductionmedialondonbrandedcontent+1 more
WordPress 6.9.4jQuery 3.7.1Google AnalyticsYoast SEO plugin+5
2026-07-02T07:25:41.652Z
rjca.co.uk favicon

Richardson Jones Chartered Accountants

rjca.co.uk

50
FinanceUnited KingdomsmallMEDIUM

Richardson Jones Chartered Accountants is a well-established independent accounting firm based in Marlow, UK, with a history dating back to 1987. The company offers a comprehensive range of financial services including taxation, auditing, business consultancy, payroll, and HR services, catering to a diverse client base from multinational corporations to individual taxpayers. The firm holds ICAEW accreditation, reinforcing its professional credibility and commitment to quality service. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site demonstrates good mobile optimization, accessibility, and performance, hosted by GoDaddy. The presence of cookie consent mechanisms and GDPR-compliant privacy policies indicates a mature approach to privacy and regulatory compliance. From a security perspective, the site uses HTTPS and employs WordFence security plugin implied by cookies, but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious activities were detected in the content or scripts. Overall, the security posture is solid but could be improved with additional headers and transparency. The website is professional, trustworthy, and safe for general audiences, with no adult or questionable content. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and maintaining regular audits of third-party components.

47
75
65
20
25
80
2
accountingcharteredaccountantstaxservicesbusinessconsultancyfinance+2 more
WordPressYoast SEO pluginjQueryGoogle Analytics+2
2026-07-02T07:23:42.300Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
ukelectronics.co.uk favicon

UK Electronics

ukelectronics.co.uk

52
ManufacturingUnited KingdommediumMEDIUM

UK Electronics is a well-established UK-based contract electronic manufacturer specializing in high-quality electronic assemblies, PCB assembly, and box build services. With over 40 years of experience, the company serves diverse sectors including military, aviation, and medical, offering a full turnkey manufacturing solution. Their UK-based facility emphasizes quality, traceability, and responsive communication, supported by multiple industry certifications such as ISO 9001, ISO 14001, and IPC standards. The website reflects a professional and comprehensive digital presence with clear service offerings and strong trust indicators. Technically, the website is built on WordPress with modern technologies including jQuery and Google Analytics GA4 for tracking. SEO and accessibility are well addressed, though some improvements in security headers and accessibility could be made. The site uses HTTPS with a cookie consent mechanism, indicating good privacy compliance. No WAF or blocking mechanisms were detected, allowing full content access. Security posture is solid with HTTPS and no exposed sensitive data, but the absence of explicit security headers and incident response information suggests room for enhancement. The WHOIS lookup for the exact subdomain failed due to naming rules, but this is a known limitation when querying subdomains rather than the registered domain. Overall, the domain and website appear legitimate and trustworthy. Recommendations include implementing additional security headers, publishing a vulnerability disclosure policy, enhancing accessibility features, and maintaining regular audits of third-party scripts to sustain security and compliance standards.

70
20
47
85
73
17
15
electronicsmanufacturingukpcbassemblycontractmanufacturing+2 more
jQuery 3.3.1Google Analytics GA4Yoast SEO pluginSlick Slider+1

Partner Domains:

bc-design.co.uk
partner
2026-07-02T07:17:57.774Z
am-energy.com favicon

A&M Energy Solutions

am-energy.com

66
EnergyUnited KingdommediumMEDIUM

A&M Energy Solutions is a UK-based medium-sized company specializing in the supply and installation of loft and cavity wall insulation products for homeowners, contractors, local authorities, and landlords. The company positions itself as a reliable energy-saving insulation contractor with multiple depots across the UK, offering bespoke solutions to improve energy efficiency and reduce energy bills. Their website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their target audiences. Technically, the website is built on WordPress using common plugins such as Gravity Forms and Yoast SEO, with integrations for Google Analytics, Google Tag Manager, Hotjar, and Trustpilot for customer reviews. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms. However, the use of an outdated jQuery version and lack of advanced security headers indicate areas for technical improvement. From a security perspective, the site enforces HTTPS and uses a consent management platform, but lacks visible security headers and incident response contact information. The absence of WHOIS registration data raises concerns about domain legitimacy, although the website content and business information appear credible. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website scores well on content quality, privacy compliance, and business credibility but could enhance its security posture and domain transparency. Strategic recommendations include updating technical components, implementing additional security headers, and publishing vulnerability disclosure information to strengthen trust and security culture.

32
85
85
100
65
80
2
energyinsulationloftinsulationcavitywallinsulationenergysaving+5 more
jQuery 1.12.4Gravity Forms pluginYoast SEO pluginGoogle Tag Manager+6
2026-07-02T07:16:57.330Z
boningale.co.uk favicon

Boningale Ltd.

boningale.co.uk

47
OtherUnited KingdomlargeHIGH

Boningale Ltd. operates one of the UK’s largest horticultural businesses, specializing in large scale nursery production and plant supply across multiple divisions. The company targets industry professionals and large projects within the horticulture and landscape sectors. Their business model focuses on multi-site production, contract growing, and a webshop for plant sales, positioning them as a key player in the UK horticulture market. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress 7.0 with modern plugins such as Yoast SEO and Google Tag Manager integration. The site is mobile-optimized and uses asynchronous loading for analytics scripts, indicating a moderate to good digital maturity. However, some accessibility features could be improved, and hosting details remain unknown. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks important security headers and does not publish a security policy or incident response contacts. The absence of a cookie consent mechanism also indicates partial GDPR compliance. The WHOIS data is unavailable and shows an error from the registry, which raises concerns about domain registration legitimacy despite the professional website presence. Overall, the site presents a low risk to users and appears trustworthy for business purposes, but the domain registration anomaly should be investigated further. Strategic improvements in security headers, privacy compliance, and transparency would enhance trust and reduce potential risks.

57
65
40
70
2
15
53
horticulturenurseryplantsukbusinessprofessional+2 more
WordPress 7.0Yoast SEO pluginjQuery 3.7.1Google Tag Manager+2
2026-07-02T07:16:03.640Z
adarchitects.co.uk favicon

AD Architects

adarchitects.co.uk

45
HealthcareUnited KingdomsmallHIGH

AD Architects is a UK-based architectural firm specializing primarily in healthcare architecture, with additional focus on education, community, and residential sectors. The company operates from Hertford and London offices and is part of the larger Sweco group. Their website presents a professional image with clear descriptions of their services, project showcases, and a commitment to sustainability and BIM technologies. The firm targets healthcare providers, educational institutions, and private clients seeking specialized architectural solutions. Their market position is that of an established regional player with a niche focus on healthcare architecture. Technically, the website is built on WordPress and uses common plugins such as Yoast SEO and AddToAny for social sharing. The site is mobile-optimized with good navigation and SEO practices. However, some technical improvements could be made, such as implementing security headers and activating Google Analytics tracking properly. The site uses HTTPS with a valid SSL certificate, ensuring secure communication. From a security perspective, the website shows a good posture with no visible vulnerabilities or exposed sensitive data. The absence of security headers and cookie consent mechanisms are areas for improvement, especially for GDPR compliance. The WHOIS data query failed due to the use of a subdomain in the lookup, but the website content and contact information strongly indicate legitimacy. No signs of malicious activity or suspicious content were found. Overall, AD Architects presents a credible and professional online presence with room for technical and compliance enhancements. Strategic improvements in security headers, privacy compliance, and analytics configuration would strengthen their digital maturity and trustworthiness.

70
57
-
70
15
2
65
healthcarearchitecturebimsustainabilityeducation+2 more
jQuery 1.11.1Yoast SEO pluginAddToAny sharing pluginGoogle Fonts (Montserrat)+1
2026-07-02T07:07:04.939Z
westhillpark.com favicon

West Hill Park School

westhillpark.com

49
EducationUnited KingdommediumHIGH

West Hill Park School is an independent preparatory school located in Hampshire, UK, offering education for children aged 2 to 13, including nursery, pre-prep, prep, and boarding services. The school emphasizes outdoor learning, small class sizes, and a supportive community environment. It is part of the Radley Schools Group and holds memberships with recognized educational associations, enhancing its market credibility. The website reflects a professional and well-structured digital presence, targeting parents and guardians seeking quality independent education for their children. Technically, the website is built on WordPress 7.0 with modern front-end libraries such as Swiper.js, AOS, and Slick Carousel, ensuring a responsive and engaging user experience. SEO is enhanced through Yoast SEO plugin and structured data (JSON-LD) is implemented for better search engine understanding. Cookie consent is managed via CookieYes, demonstrating GDPR compliance. Hosting is provided by Fasthosts Internet Ltd, a reputable provider. From a security perspective, the site uses HTTPS with no visible critical vulnerabilities. It employs Google reCAPTCHA to mitigate spam and bot attacks and provides granular cookie consent options. However, there is no explicit security policy or incident response information published, which could be improved to enhance transparency and trust. Overall, West Hill Park School's website is a secure, compliant, and professionally maintained platform that effectively supports its educational mission and business objectives. Strategic recommendations include publishing a dedicated security policy, incident response contacts, and vulnerability disclosure information to further strengthen security posture and stakeholder confidence.

40
65
27
70
15
2
83
educationprepschoolnurseryboardinghampshire+2 more
WordPress 7.0Yoast SEO pluginjQuery 3.7.1Slick Carousel+6

Partner Domains:

westhillpark.schoolsbuddy.net
partner
accounts1.schoolsbuddy.net
partner

+3 more partners

2026-07-02T07:06:11.159Z
c22.co.uk favicon

Catch22

c22.co.uk

47
OtherUnited KingdommediumHIGH

Catch22 is a UK-based facilities management recruitment agency with over 40 years of industry experience. The company specializes in providing tailored recruitment solutions across executive, technical, business support, and operational support sectors within facilities management. Positioned as the UK's leading FM recruitment company, Catch22 serves both clients and candidates with a comprehensive service offering including permanent, temporary, and contract staffing. The website reflects a professional brand with consistent messaging and strong industry certifications, reinforcing its market position. Technically, the website is built on WordPress 7.0, leveraging popular plugins such as Yoast SEO and Gravity Forms, and integrates Google Analytics and Tag Manager for tracking. The site demonstrates good mobile optimization and SEO practices, although accessibility features are basic. Performance is moderate with modern web technologies in use. From a security perspective, the site uses HTTPS and secure form handling but lacks visible security headers and published privacy or cookie policies, which are critical for compliance and user trust. The WHOIS data for the domain is unavailable and indicates a registration error, which raises concerns about domain legitimacy despite the professional website presence. No incident response or vulnerability disclosure information is found. Overall, Catch22 presents a credible and professional online presence for its recruitment business, but improvements in transparency around privacy, security policies, and domain registration clarity are recommended to enhance trust and compliance.

20
57
60
85
15
17
53
facilitiesmanagementrecruitmentjobsukstaffing+2 more
WordPress 7.0Yoast SEO pluginGravity FormsGoogle Analytics+2

Partner Domains:

careers.c22.co.uk
service
2026-07-01T07:24:33.148Z
B

Bank of Montana

bankofmontana.com

61
FinanceUnited StatesmediumMEDIUM

Bank of Montana is a well-established regional financial institution specializing in business and private banking services, with a strong market position in Montana and surrounding states. The bank offers a range of specialized loan products including multifamily financing, aviation financing, and small business loans, supported by government-enhanced loan programs. Recognized as one of MSN Money's safest banks, it targets entrepreneurs and business clients seeking tailored financial solutions. The website reflects a professional and consistent brand image with clear navigation and relevant content for its audience. Technically, the website is built on WordPress with modern technologies such as jQuery and Modernizr, and integrates accessibility tools like AudioEye. Hosting and DNS are managed via Cloudflare, ensuring good performance and security. SEO and accessibility optimizations are evident, though some improvements in cookie consent and security headers could enhance compliance and security posture. Security-wise, the site enforces HTTPS and uses clientTransferProhibited domain status, but lacks DNSSEC and some security headers. There is no visible security policy or incident response contact information, which could be improved to bolster trust and compliance. No critical vulnerabilities or WAF blocking were detected, indicating a stable security baseline. Overall, the website and domain demonstrate high business credibility and a solid technical foundation, with moderate privacy compliance and security posture. Strategic enhancements in privacy mechanisms and security policies would further strengthen the bank's digital trustworthiness and regulatory adherence.

15
53
17
100
37
80
100
bankingbusinessbankingprivatebankingfinancemontana+3 more
jQuery 1.12.4Modernizr 2.7.0Google Analytics (ga.js)AudioEye accessibility scripts+1
2026-07-01T07:16:22.282Z
strayaid.org.uk favicon

Durham Dogs & Cats Home

strayaid.org.uk

53
Non-profitUnited KingdomsmallMEDIUM

Durham Dogs & Cats Home is a UK-based non-profit charity dedicated to rescuing, rehabilitating, and rehoming dogs and cats in need, primarily in the North East of England. The organization operates through donations, volunteer support, and charity shops, emphasizing compassion and high standards of animal welfare. Their website reflects a professional and consistent brand with clear calls to action for adoption, volunteering, and donations. The charity is registered and displays trust indicators such as membership in recognized associations and regulatory bodies. Technically, the website is built on WordPress with modern plugins and libraries, including Yoast SEO, Contact Form 7, and Owl Carousel. It is hosted by ANS Group Ltd (UKFAST) and uses HTTPS with good SSL configuration. The site is mobile-optimized and SEO-friendly but lacks some advanced accessibility features and security headers. Tracking technologies like Google Analytics and Facebook Pixel are used without a visible cookie consent mechanism, which may pose privacy compliance risks. From a security perspective, the site employs HTTPS and avoids exposing sensitive data but could improve by implementing security headers and publishing formal security policies. The WHOIS data shows inconsistencies with future domain creation dates, which reduces trust in domain registration information but does not necessarily reflect on the charity's legitimacy, supported by external trust signals. Overall, the website is trustworthy and professional, serving its target audience effectively. However, improvements in privacy compliance and security best practices are recommended to enhance user trust and regulatory adherence.

42
60
70
100
53
2
15
animalrescuecharitydogadoptioncatadoptionnon-profit+1 more
WordPress 7.0Yoast SEO pluginjQuery 3.7.1Owl Carousel+2

Partner Domains:

www.adch.org.uk
partner
www.fundraisingregulator.org.uk
partner

+1 more partners

2026-07-01T07:11:43.104Z
avtree.co.uk favicon

Arbor Vitae Arboriculture Ltd

avtree.co.uk

56
OtherUnited KingdomsmallMEDIUM

Arbor Vitae Arboriculture Ltd is a small, specialized tree consultancy and arboriculture service provider based in Scotland, primarily serving Edinburgh and surrounding areas. Founded in 2011 and led by an experienced consulting arborist, the company offers a comprehensive range of services including tree inspections, BS5837 surveys, tree protection, and woodland management. The website reflects a professional and well-established business with strong local trust indicators such as industry memberships and accreditations. Technically, the website is built on WordPress with modern plugins for SEO and GDPR compliance, including Google Tag Manager for analytics and Complianz for cookie consent management. The site is mobile-optimized and demonstrates good SEO practices, although some accessibility features could be enhanced. The performance is moderate, with a clean and navigable design. From a security perspective, the site uses HTTPS and cookie consent mechanisms effectively but lacks explicit security policy documentation and some advanced security headers. No vulnerabilities or exposed sensitive data were detected. The WHOIS data for the domain is unavailable due to a Nominet registration error, which is unusual but does not appear to impact the legitimacy or operation of the website. Overall, the website presents a trustworthy and professional front for Arbor Vitae Arboriculture Ltd, with minor recommendations to improve security posture and accessibility. The domain WHOIS anomaly should be investigated further to ensure full compliance and transparency.

70
40
57
60
40
2
80
arboriculturetreeconsultancytreesurveysbs5837treeprotection+4 more
WordPress 6.8.5jQuery 3.7.1BootstrapFontAwesome+3
2026-06-30T07:21:11.306Z
mitchellsworktops.co.uk favicon

Mitchells Millbrook Limited

mitchellsworktops.co.uk

49
RetailUnited KingdomsmallHIGH

Mitchells Millbrook Limited operates a specialized retail and trade business supplying kitchen worktops and bathroom surfaces from Southampton, UK. With over 70 years of experience, they maintain a large stock and offer custom fabrication services supported by onsite workshop facilities. Their target market includes both trade professionals and retail customers primarily in the South of England. The website reflects a professional and established business with clear service offerings and local delivery capabilities. Technically, the website is built on WordPress using modern plugins such as Yoast SEO and WP Rocket, ensuring good SEO and performance optimization. The site is mobile responsive and provides a good user experience with clear navigation and relevant content. However, there is room for improvement in accessibility and security headers implementation. From a security perspective, the site uses HTTPS and does not expose sensitive data. However, it lacks visible security headers and formal security or incident response policies. Privacy compliance is weak due to the absence of privacy and cookie policies and no consent mechanisms. The WHOIS data is unavailable due to a domain lookup error, which limits trust assessment from a domain registration perspective. Overall, the website is functional, professional, and trustworthy from a business and content perspective but should improve privacy compliance and security best practices to enhance user trust and regulatory adherence.

27
100
85
55
2
35
15
kitchenworktopsbathroomsurfaceslaminateworktopssolidwoodworktopssolidsurfaceworktops+2 more
WordPressYoast SEO pluginjQueryMetaSlider+2
2026-06-30T07:09:44.117Z
celsur.co.uk favicon

Duraweld

celsur.co.uk

53
ManufacturingUnited KingdomsmallMEDIUM

Duraweld is a UK-based manufacturer specializing in bespoke office stationery and custom retail packaging, including ring binders, clipboards, document pockets, wallets, presentation boxes, and product packaging. The company positions itself as a leading provider of durable and versatile stationery and packaging solutions for businesses. The website reflects a professional and consistent brand image, targeting business customers seeking custom packaging and stationery products. The business has a long-standing domain registration dating back to 1996, supporting its established market presence. Technically, the website is built on WordPress 7.0, utilizing popular plugins such as Yoast SEO for search engine optimization, Google Tag Manager and Google Analytics for tracking, and a cookie consent plugin to comply with privacy regulations. The site is mobile-optimized with good navigation and content relevance. Hosting and domain registration are managed by NuBlue Ltd, a reputable registrar. From a security perspective, the site enforces HTTPS with a valid SSL certificate and implements a cookie consent mechanism. However, it lacks visible security headers and does not publish explicit security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected in the provided content. Privacy compliance is basic, with no explicit privacy policy or terms of service pages found, which could be improved to enhance user trust and regulatory compliance. Overall, Duraweld's website demonstrates a solid business and technical foundation with room for improvement in privacy and security transparency. Strategic recommendations include publishing comprehensive privacy and security policies, implementing security headers, and providing incident response contact information to strengthen compliance and trust.

70
85
57
20
30
17
65
manufacturingcustompackagingofficestationeryringbindersb2b+1 more
WordPress 7.0Yoast SEO pluginGoogle Tag ManagerGoogle Analytics+3
2026-06-29T07:15:44.868Z
U

Utility Workers Union of America, AFL-CIO

uwua.net

58
EnergyUnited StateslargeMEDIUM

The Utility Workers Union of America (UWUA), AFL-CIO, is a well-established labor union representing approximately 45,000 members in the American utility sectors. The website serves as a comprehensive platform for union news, member resources, legislative advocacy, and educational content. The union has a strong market position with a long history dating back to 1946, supported by a domain registered since 2000, reflecting organizational maturity and legitimacy. The site targets utility workers and union members, providing them with tools, updates, and community engagement opportunities. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and uses popular plugins like Yoast SEO for optimization. It integrates social media feeds and uses Google Tag Manager for analytics, indicating a moderate level of digital maturity. The site is mobile-optimized and offers a good user experience with clear navigation and professional design. From a security perspective, the site uses HTTPS with a strong SSL configuration and domain registration protections. However, it lacks DNSSEC and security headers, which are recommended to enhance security posture. Privacy compliance is limited due to the absence of explicit privacy and cookie policies and consent mechanisms. No incident response or vulnerability disclosure information is present, which could be improved to bolster trust and compliance. Overall, the UWUA website is a credible and professional platform for its union members and stakeholders. Strategic improvements in privacy compliance, security headers, and incident response transparency would enhance its security posture and regulatory adherence.

85
37
100
85
15
35
25
unionlaborenergyutilityworkersafety+1 more
WordPressYoast SEO pluginjQueryBootstrap (offcanvas, navbar)+3
2026-06-29T07:13:01.077Z
eildon.org.uk favicon

Eildon Housing

eildon.org.uk

67
Real EstateUnited KingdommediumMEDIUM

Eildon Housing is a well-established non-profit housing association operating in the Scottish Borders region, providing affordable homes and supported housing for over 50 years. The organization targets residents seeking affordable rental options, shared ownership, and community support housing. Their market position is strong regionally, supported by a professional website that clearly communicates their services and contact information. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO, Google Analytics, and Google Tag Manager. The site demonstrates good mobile optimization, accessibility, and performance. Cookie consent and privacy policies are implemented in compliance with GDPR standards. From a security perspective, the site uses HTTPS with strong SSL configuration and appropriate security headers. However, there is no publicly available security policy or incident response information, which could be improved to enhance transparency and trust. No vulnerabilities or exposed sensitive data were detected. Overall, the website presents a low-risk profile with a solid business credibility and privacy compliance posture. The main limitation is the lack of WHOIS data due to domain registration query issues, but this does not detract from the legitimacy of the organization or website. Strategic recommendations include publishing a security policy, incident response contacts, and vulnerability disclosure information to further strengthen security posture and stakeholder trust.

52
85
100
70
2
80
65
housingaffordablehomesnon-profitscottishborderssupportedhousing+2 more
WordPressYoast SEO pluginjQuery 3.5.1Google Analytics+2

Partner Domains:

www.eildonhomes.org.uk
partner
2026-06-29T07:08:31.772Z
surescaff.co.uk favicon

SureScaff Limited

surescaff.co.uk

34
OtherUnited KingdomsmallHIGH

SureScaff Limited is a small family-owned business specializing in providing safe access scaffolding and working platforms primarily serving North Wales and the North West of England. The company targets local builders, roofers, decorators, construction companies, and local authorities, positioning itself as a leading supplier in its regional market. The website reflects a professional service provider with clear contact details and a focus on safety and reliability in scaffolding services. Technically, the website is built on WordPress using common plugins such as Yoast SEO and Contact Form 7, with a moderate performance profile and good mobile optimization. The hosting is provided by Heart Internet Limited, a reputable registrar and hosting provider. The site uses HTTPS but lacks advanced security headers and privacy compliance features, indicating room for improvement in security and regulatory adherence. From a security perspective, the site has basic protections with no visible vulnerabilities or WAF blocking. However, the absence of privacy and cookie policies and missing security headers reduce its compliance posture. There is no evidence of incident response or vulnerability disclosure mechanisms. Overall, the security posture is moderate but could be enhanced with standard best practices. The overall risk assessment is moderate with a recommendation to implement privacy and cookie policies, improve security headers, and establish incident response contacts. These steps will enhance trust, compliance, and security maturity, supporting the company’s professional image and business continuity.

40
47
-
60
35
15
2
scaffoldingconstructionworkingplatformsnorthwalessafeaccess
WordPressPHPjQueryYoast SEO plugin+4
2026-06-29T07:07:49.495Z
aclu.org favicon

American Civil Liberties Union

aclu.org

67
Non-profitUnited StateslargeMEDIUM

The American Civil Liberties Union (ACLU) is a well-established non-profit organization dedicated to defending and expanding civil liberties and constitutional rights across the United States. The website serves as a comprehensive platform for advocacy, education, and fundraising, targeting a broad audience including activists, donors, and the general public. It offers detailed information on key civil rights issues, campaigns, legal battles, and resources such as 'Know Your Rights' materials. The ACLU maintains a strong market position as a leading civil liberties organization with a large national presence. Technically, the website is built on WordPress with modern enhancements including Vue.js components, Yoast SEO for optimization, and integrations with analytics and marketing tools like Heap and Optimizely. The site demonstrates good mobile responsiveness, accessibility, and SEO practices, contributing to a positive user experience. Performance is moderate, with room for optimization in hosting and resource delivery. From a security perspective, the site enforces HTTPS and uses secure forms for data collection. However, explicit security headers are not detected in the provided data, and no public security or incident response policies are found. The absence of a vulnerability disclosure or security.txt file suggests an opportunity for improvement in transparency and security maturity. No vulnerabilities or suspicious elements are evident in the content or scripts. Overall, the ACLU website is a trustworthy, professional, and content-rich platform that effectively supports the organization's mission. The domain registration data is privacy-protected but consistent with the organization's long-standing history. Strategic recommendations include enhancing security header implementation, publishing security policies, and adding vulnerability disclosure mechanisms to further strengthen trust and security posture.

85
100
80
59
53
17
55
civillibertiesnon-profitadvocacylegalrightseducation+2 more
WordPress 6.9.4Yoast SEO pluginOptimizelyHeap Analytics+1

Partner Domains:

shop.aclu.org
partner
action.aclu.org
partner
2026-06-28T07:26:32.861Z
accesshirenationwide.com favicon

Kelling

accesshirenationwide.com

65
TransportationUnited KingdomlargeMEDIUM

Kelling is a leading specialist access hire company operating across the UK and Ireland, offering a large and modern fleet of van-mounted MEWPs, 4X4 MEWPs, pole erection units, and vehicle platforms. The company emphasizes safety, compliance, and efficiency, serving critical infrastructure sectors such as power, telecoms, street lighting, and local authorities. Their business model includes hire, lease, full-service maintenance, and next-day nationwide delivery, supported by 24/7/365 specialist teams. The website reflects a strong market position as the UK's number one specialist access hire partner, with professional branding and comprehensive product offerings. Technically, the website is built on WordPress 7.0 with modern plugins like Yoast SEO and Cookiebot for privacy compliance. It uses Google Tag Manager and Google Analytics for tracking and performance monitoring. The site is mobile-optimized, accessible, and SEO-friendly, with good performance and structured data enhancing search visibility. Security measures include HTTPS, reCAPTCHA, and cookie consent mechanisms, although explicit security headers could be improved. From a security perspective, the site shows a mature posture with no visible vulnerabilities or exposed sensitive data. However, the lack of WHOIS data raises some concerns about domain registration transparency. Privacy compliance is good with cookie consent and GDPR indicators, but no explicit privacy policy or terms of service pages were found in the provided content. Contact information is clearly presented, supporting business credibility. Overall, the website presents a professional, trustworthy, and well-maintained digital presence for Kelling, supporting its business objectives effectively. Strategic recommendations include enhancing security headers, publishing clear privacy and security policies, and verifying domain registration details to improve trust and compliance further.

15
95
2
85
57
80
100
accesshirespecialistfleetmewppoleerectionunitsvehicleplatforms+4 more
WordPress 7.0Yoast SEO pluginGoogle Tag ManagerCookiebot+2
2026-06-28T07:19:20.022Z
M

Meiji Techno UK, Limited

meijitechno.co.uk

53
ManufacturingUnited KingdomsmallMEDIUM

Meiji Techno UK, Limited is a specialized manufacturer and supplier of quality microscopes and related accessories, serving educational institutions, laboratories, and industrial manufacturing facilities primarily in the UK. With over 50 years of experience, the company emphasizes product quality, backed by limited lifetime warranties and rigorous quality control. The website reflects a well-established niche business with a clear market position and professional presentation. Technically, the website is built on WordPress with common plugins such as Yoast SEO and Google Analytics integrated for SEO and user tracking. The site is mobile-optimized with good navigation and performance, although some accessibility features are basic. The technical infrastructure is modern but could benefit from enhanced security headers and explicit privacy mechanisms. From a security perspective, the site uses HTTPS and secure contact forms, with no visible vulnerabilities or exposed sensitive data. However, it lacks explicit security policies, incident response information, and cookie consent mechanisms, which are important for compliance and user trust. The WHOIS data confirms domain legitimacy with a long registration history consistent with the business claims. Overall, the website is professional and trustworthy but could improve privacy compliance and security transparency to enhance user confidence and regulatory adherence.

55
62
85
20
55
17
53
microscopesscientificequipmentmanufacturingeducationlaboratory+1 more
WordPressYoast SEO pluginGoogle AnalyticsjQuery+3
2026-06-28T07:07:51.550Z