Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 6 of 128|Showing 251-300 of 6391
dejurepharmacy.co.uk favicon

dejurepharmacy.co.uk — Premium Domain For Sale | Atom

dejurepharmacy.co.uk

71
OtherN/asmallMEDIUM

The website represents a premium domain sales page hosted on atom.com, specifically offering the domain dejurepharmacy.co.uk for purchase. The business operates as a domain marketplace, providing verified premium domains with options for installment payments and free transaction support. The site targets domain buyers and investors seeking high-value domain names. Technically, the site employs modern web technologies including Google Tag Manager, Google reCAPTCHA for bot protection, and New Relic for performance monitoring. The site is served over HTTPS with a valid SSL certificate, ensuring secure communications. However, explicit security headers and privacy policies are not evident, indicating room for improvement in compliance and security best practices. The absence of WHOIS data for the atom.com domain introduces some uncertainty regarding domain registration legitimacy, though the site content and branding appear professional and consistent with its business model. Overall, the site presents a moderate security posture with good technical implementation but lacks comprehensive privacy and contact information. Strategic recommendations include adding privacy and cookie policies, implementing security headers, and providing clear contact and incident response details to enhance trust and compliance.

37
100
100
85
17
73
80
premiumdomaindomainmarketplacedomainforsaleatomcomdejurepharmacycouk
Google Tag ManagerGoogle reCAPTCHANew Relic Browser MonitoringGoogle Fonts+2
2026-07-08T07:23:32.507Z
F

First Step

firststep.org.uk

41
Non-profitUnited KingdomsmallHIGH

First Step is a UK-based non-profit organization dedicated to providing family support services for children with special needs and/or disabilities. With over 35 years of operation, it holds a reputable position in its local community, offering services such as fundraising, events, and volunteering opportunities. The website reflects a focused mission to support families, with clear contact channels and social media presence enhancing its outreach. Technically, the website is built on WordPress using popular plugins like Yoast SEO, Contact Form 7, and Smart Slider 3. It employs Google Analytics and Google reCAPTCHA for analytics and form security respectively. The site is mobile-optimized and demonstrates good SEO practices, though some accessibility features are basic. Performance is moderate, with room for optimization. Security posture is generally good with HTTPS enforced and reCAPTCHA protecting forms. However, the absence of security headers and lack of visible privacy and cookie policies indicate areas for improvement. The WHOIS data is unavailable due to a domain query error, but the website content and contact information suggest legitimacy. Overall, the website is professional and trustworthy, but enhancing privacy compliance and security headers would strengthen its security and user trust. Strategic recommendations include publishing comprehensive privacy and cookie policies, implementing security headers, and maintaining regular updates to plugins and CMS.

70
20
47
65
15
2
35
non-profitfamilysupportdisabilitiescharityuk+1 more
WordPressYoast SEOContact Form 7Google reCAPTCHA+4
2026-07-08T07:19:33.026Z
researchbydesign.co.uk favicon

Research by Design Ltd

researchbydesign.co.uk

58
OtherUnited KingdomsmallMEDIUM

Research by Design Ltd is a specialized market research agency focused on serving membership organizations. Established in 1994 and operating under the parent company Box Delta Insights, it holds a leading position in its niche market. The company offers a broad range of services including member engagement, value proposition development, diversity and inclusion research, and sector benchmarking. Their client base includes prominent professional bodies and associations, supported by strong testimonials and case studies. The website reflects a professional and trustworthy brand image with clear communication of services and client success stories. Technically, the website is built on WordPress and leverages modern web technologies such as Google reCAPTCHA for form security, Yoast SEO for search optimization, and Cloudflare for hosting and domain registration. The site is mobile-optimized, fast-loading, and accessible, with comprehensive SEO metadata and structured data enhancing its digital maturity. Privacy and cookie policies are present with consent mechanisms, indicating good compliance with GDPR requirements. From a security perspective, the site uses HTTPS with a valid SSL certificate and employs clientTransferProhibited status on the domain to prevent unauthorized transfers. However, DNSSEC is not enabled, and security headers are not explicitly detected, suggesting room for improvement. No vulnerabilities or exposed sensitive data were found. Incident response and security policy documents are not publicly available, which could be enhanced to improve transparency and readiness. Overall, the website presents a low-risk profile with strong business credibility and good privacy compliance. Strategic recommendations include enabling DNSSEC, adding security headers, and publishing security policies to further strengthen the security posture and trustworthiness.

37
70
85
100
68
15
2
marketresearchmembershipconsultingprofessionalservicesuk
JavaScriptGoogle reCAPTCHAYoast SEOContact Form 7

Partner Domains:

boxdeltagroup.com
parent
memcom.com
partner
2026-07-08T07:09:42.868Z
redvape.com favicon

Red Vape Ltd

redvape.com

51
RetailUnited KingdomsmallMEDIUM

Red Vape Ltd is a UK-based manufacturer and retailer specializing in premium gourmet e-liquids, focusing on natural ingredients and luxury tobacco flavors. The company positions itself as a leading UK luxury e-liquid brand with a strong emphasis on quality, compliance, and customer service. Their product range includes naturally extracted tobacco e-liquids, premium flavored e-liquids, zero nicotine options, and high VG blends, catering to vaping enthusiasts seeking high-quality products. The website is professionally designed, mobile-optimized, and uses modern e-commerce technologies including WordPress and WooCommerce, supported by Google Tag Manager and Sendinblue for marketing and analytics. Security measures such as HTTPS and Google reCAPTCHA are implemented, though some security headers could be improved. Privacy and cookie policies are comprehensive and GDPR compliant, with clear contact information and social media presence enhancing trust. However, the absence of WHOIS domain registration data raises some concerns about domain transparency, which should be addressed to improve business credibility. Overall, Red Vape demonstrates a mature digital presence with good security posture and compliance, serving a niche market in the UK vaping industry.

57
75
65
20
2
88
15
e-liquidvapingtobaccoukgourmet+4 more
WordPressWooCommerceWPBakery Page BuilderGoogle Tag Manager+6

Partner Domains:

access.worldpay.com
partner
2026-07-08T07:06:42.199Z
ascoeng.com favicon

ASCO Engineering & Surface Technology

ascoeng.com

59
ManufacturingUnited KingdommediumMEDIUM

ASCO Engineering & Surface Technology is a well-established industrial company specializing in surface coating, precision machining, thermal spray coating, and laser cladding services. With over 80 years of experience, the company serves a diverse range of sectors including oil & gas, aerospace, power generation, and renewable energy. The business operates from the UK and Dubai, providing global clients with advanced engineering solutions. Their website reflects a professional and consistent brand image, showcasing key services, client partnerships, and certifications that reinforce their market position. Technically, the website is built on Joomla CMS with modern frameworks such as Gantry5 and Bootstrap, incorporating essential tools like Google Tag Manager and reCAPTCHA for analytics and security. The site is mobile-optimized with good SEO practices, although some accessibility features could be enhanced. Security posture is solid with HTTPS and bot protection, but lacks some recommended security headers and explicit incident response information. The WHOIS data is notably missing or unavailable, which raises some concerns about domain registration transparency. Despite this, the website content and business information appear legitimate and trustworthy. Privacy and cookie policies are well implemented, indicating compliance with GDPR and related regulations. Overall, the site presents a credible business front with room for improvement in security disclosures and WHOIS transparency.

69
75
20
75
53
85
17
manufacturingengineeringsurfacecoatingprecisionmachiningthermalspray+3 more
Joomla CMSjQueryBootstrapGantry5 Framework+4
2026-07-07T07:09:27.829Z
edinburghsashwindows.co.uk favicon

Illingworth Brothers

edinburghsashwindows.co.uk

53
Real EstateUnited KingdomsmallMEDIUM

Illingworth Brothers is a small, family-run business specializing in the manufacture and installation of traditional sash and case windows, wooden doors, and UPVC windows and doors primarily serving Edinburgh and the surrounding Lothian area. The company emphasizes quality craftsmanship with over 60 years of experience and offers a range of products designed to meet conservation and energy efficiency standards. The website reflects a professional and consistent brand image with clear contact information and customer testimonials, positioning the company as a trusted local specialist in home improvement products. Technically, the website employs common web technologies including jQuery, Google Analytics, Google reCAPTCHA for form security, and media players for enhanced user experience. The site is moderately optimized for mobile devices and SEO, with a clear navigation structure and relevant meta tags. However, there is no evidence of a CMS or advanced frameworks, and performance is moderate. Security measures include HTTPS and reCAPTCHA, but the absence of explicit security headers and detailed security policies indicates room for improvement. From a security perspective, the site shows moderate maturity with basic protections in place but lacks comprehensive security headers and incident response information. The WHOIS data is unavailable due to domain naming errors, which raises concerns about domain registration consistency and trustworthiness. No critical vulnerabilities or malware indicators were found, but the site would benefit from enhanced security practices and transparency. Overall, the website is functional, professional, and trustworthy for its business purpose but should address domain registration inconsistencies and strengthen security posture to improve trust and compliance.

32
65
70
100
15
68
2
sashwindowsupvcwindowswoodendoorsdoubleglazingedinburgh+1 more
jQueryGoogle AnalyticsGoogle reCAPTCHAjPlayer+1
2026-07-06T07:23:24.050Z
M

Maximum Protection Services Ltd

maximumprotectionservices.com

60
OtherUnited KingdommediumMEDIUM

Maximum Protection Services Ltd is a UK-based security service provider with over 40 years of experience delivering intelligent, innovative, and cost-effective security solutions. The company holds prestigious NSI Gold accreditation and operates an in-house alarm receiving center compliant with BS8418 and BS5979 standards. Their key services include CCTV systems, intruder alarms, access control, fire alarms, rapid deployment, canine services, remote monitoring, and automated gates and barriers. The website reflects a professional and consistent brand image targeting businesses requiring comprehensive security solutions. Technically, the website is built on the Squarespace platform, utilizing modern web technologies such as Google Fonts and Google reCAPTCHA for form security. The site is mobile-optimized with moderate performance and basic SEO and accessibility features. Security posture is good with HTTPS and HSTS enabled, though DNSSEC is not enabled and advanced security headers are missing. Privacy compliance is limited due to the absence of a privacy policy and terms of service, though a cookie consent banner is present. Overall, the security posture is solid but could be improved by publishing security policies, enabling DNSSEC, and adding vulnerability disclosure mechanisms. The domain registration data is consistent with the business claims, supporting legitimacy. The website content is safe for general audiences and professionally presented.

40
100
54
45
95
17
50
securitynsigoldfiresafetymonitoringcctv+2 more
Squarespace CMSGoogle Fonts (Poppins)Google reCAPTCHAPlyr video player
2026-07-05T07:23:43.445Z
brittensinfonia.com favicon

Britten Sinfonia

brittensinfonia.com

67
OtherUnited KingdommediumMEDIUM

Britten Sinfonia is a distinguished chamber orchestra based in the United Kingdom, recognized as one of Europe's premier ensembles and the only professional orchestra serving the East of England region. The organization focuses on delivering high-quality live orchestral performances, community engagement, and educational outreach, targeting classical music enthusiasts and regional audiences. Their market position is strong within the cultural and arts sector, emphasizing professional musicianship and regional cultural enrichment. Technically, the website employs modern web standards including HTML5, CSS3, and JavaScript, with integrations such as Google reCAPTCHA and Mailchimp for security and marketing. The site is well-optimized for mobile devices and accessibility, with good SEO practices and a professional design. Security posture is solid with HTTPS enforcement and security headers, though explicit security policies and incident response information are not published. The absence of WHOIS registration data is a notable anomaly that slightly reduces trustworthiness but does not detract from the overall professional presentation. Strategic recommendations include publishing detailed security and incident response policies, adding vulnerability disclosure mechanisms, and maintaining vigilance on third-party scripts. Overall, Britten Sinfonia presents a credible, secure, and user-friendly digital presence aligned with its cultural mission.

65
65
17
70
72
65
100
classicalmusicorchestrachamberorchestraukarts+1 more
HTML5CSS3JavaScriptGoogle reCAPTCHA+2
2026-07-05T07:20:21.838Z
savi.com favicon

Savi Technology

savi.com

56
TechnologyUnited StatesmediumMEDIUM

Savi Technology is a well-established company specializing in supply chain visibility and asset tracking solutions, leveraging IoT and machine learning to provide real-time data and analytics. Their market position is strong, serving government, military, and commercial sectors with over 30 years of experience. The website reflects a professional and consistent brand with clear messaging and relevant content targeting organizations requiring enhanced supply chain security and performance. Technically, the website is built on WordPress with modern frameworks like Bootstrap and uses various analytics and marketing tools including Google Tag Manager, LinkedIn Insight, and reCAPTCHA for security. The site is mobile-optimized and SEO-friendly, though some accessibility features could be improved. Security posture is good with HTTPS enforced and security plugins active, but explicit security headers and cookie consent mechanisms are missing. The WHOIS data is unavailable, which slightly reduces trust in domain legitimacy, but the overall business credibility remains high due to consistent branding, social media presence, and detailed business information. No signs of WAF blocking or content restrictions were detected, allowing a full analysis. Strategic recommendations include enhancing security headers, implementing cookie consent for GDPR compliance, publishing a vulnerability disclosure policy, and providing incident response contact details to improve transparency and trust.

70
47
70
100
15
53
17
supplychainiotlogisticstechnologygovernment+2 more
WordPressBootstrapjQueryFontAwesome+6

Partner Domains:

www.savirfidcatalog.net
partner
savirfidcatalog.com
partner
2026-07-05T07:18:25.688Z
numc.edu favicon

NuHealth

numc.edu

50
HealthcareUnited StateslargeMEDIUM

Nassau University Medical Center (NUMC), operating under the NuHealth system, is a large healthcare provider and teaching hospital located in East Meadow, New York. Established in 1935, it serves as the primary medical care source for Nassau County. The website presents a comprehensive range of healthcare services including maternity, bariatric surgery, mental health, emergency care, and primary care, targeting patients, visitors, and medical professionals. The institution maintains a strong market position with multiple centers of care and community partnerships. Technically, the website is built on WordPress with modern frameworks like Bootstrap and integrates Google Analytics and Tag Manager for tracking. It supports multiple languages via GTranslate and implements Google reCAPTCHA for form security. Security posture is good with HTTPS enforced and no visible vulnerabilities, though security headers are not explicitly detected. Privacy compliance is basic, with a privacy policy present but lacking explicit cookie consent mechanisms. WHOIS data is missing, which reduces domain transparency but the website content and external references strongly support legitimacy. Overall, the site is professional, secure, and user-friendly, with room for improvement in privacy and security disclosures.

47
85
75
40
15
53
2
healthcarehospitalmedicalcenterpatientcareeducation+2 more
WordPressYoast SEOGoogle AnalyticsGoogle Tag Manager+5

Partner Domains:

harmonyhealthcareli.org
partner
numc.followmyhealth.com
service
2026-07-05T07:12:20.418Z
mitc.com favicon

Maine International Trade Center

mitc.com

64
GovernmentUnited StatesmediumMEDIUM

The Maine International Trade Center (MITC) is a non-profit organization dedicated to supporting Maine companies in expanding their presence in global markets. The website positions MITC as the leading source for international business assistance in Maine, offering services such as one-on-one assistance, education, events, and funding support. The organization targets Maine-based businesses seeking guidance and resources to grow their export sales and global reach. The site features a professional design with clear navigation and strong branding consistency, supported by partnerships with reputable financial and industry organizations. Technically, the website is built on WordPress using Elementor and Gravity Forms, with modern web technologies and Google Analytics integration. Security posture is strong with HTTPS, security headers, and CAPTCHA protections, though no explicit security policy or incident response information is published. The absence of WHOIS data for the domain is a notable concern, reducing transparency and trustworthiness despite the site's professional appearance and business legitimacy. Overall, the site demonstrates a mature digital presence with room for improvement in security transparency and domain registration clarity.

69
100
55
75
80
53
2
internationaltradebusinesssupporteducationfundingmaine+3 more
WordPressElementorGravity FormsGoogle reCAPTCHA+2

Partner Domains:

about.bankofamerica.com
partner
www.key.com
partner

+3 more partners

2026-07-05T07:10:30.027Z
B

Bow House Digital Ltd

bowhouse.co.uk

47
TechnologyUnited KingdomsmallHIGH

Bow House Digital Ltd is a small, established digital agency based in York, United Kingdom, specializing in web design, SEO, WordPress websites, e-commerce, branding, and digital marketing services. With over 25 years of industry experience, the company targets businesses in York and North Yorkshire seeking to enhance their online presence and digital marketing effectiveness. The website reflects a professional and consistent brand image, supported by client testimonials and a portfolio of recent projects, positioning Bow House as a trusted local partner in digital services. Technically, the website is built on WordPress CMS, leveraging modern JavaScript libraries such as jQuery, GSAP, and Slick Carousel for enhanced user experience. It integrates Google Tag Manager and LinkedIn Insight for analytics and marketing, and employs Google reCAPTCHA to secure its contact forms. The site is mobile-optimized and SEO-friendly, with comprehensive metadata and structured data enhancing search visibility. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to mitigate spam. However, it lacks explicit security headers like Content-Security-Policy and X-Frame-Options, which are recommended to strengthen security posture. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy and cookie policies are present and indicate GDPR compliance, supporting responsible data handling. Overall, the website demonstrates a strong digital maturity and business credibility with minor areas for security enhancement. The absence of WHOIS data due to a domain query error does not detract from the legitimacy of the business, as corroborated by company registration details and consistent branding. Strategic recommendations include implementing additional security headers, enhancing accessibility, and maintaining up-to-date software to mitigate potential risks.

60
67
-
65
68
15
17
webdesigndigitalmarketingseowordpresse-commerce+3 more
WordPressjQueryGSAPSlick Carousel+3
2026-07-05T07:09:36.961Z
newhopetoungardens.co.uk favicon

New Hopetoun Gardens

newhopetoungardens.co.uk

48
RetailUnited KingdomsmallHIGH

New Hopetoun Gardens is an established, employee-owned garden centre located near Edinburgh, UK, with over 40 years of history. The business offers a wide range of garden plants, gifts, a tearoom, and hosts events such as the Art in the Garden. The website reflects a strong local retail presence with a focus on gardening enthusiasts and the local community. The company emphasizes quality, customer service, and sustainability, evidenced by its Living Wage Employer certification. Technically, the website is built on WordPress using the GeneratePress theme, incorporating modern web technologies such as jQuery, Google reCAPTCHA for form security, and Facebook Pixel for marketing analytics. The site is mobile-optimized, accessible, and SEO-friendly, providing a good user experience with clear navigation and rich content. From a security perspective, the site uses HTTPS and implements Google reCAPTCHA on its contact forms, along with a cookie consent mechanism compliant with GDPR. However, it lacks some recommended security headers which could enhance protection. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy and professional digital presence for a small retail business. The absence of WHOIS data due to domain naming rules is a limitation but does not detract significantly from the site's legitimacy given the strong business and trust signals present.

55
65
47
20
15
80
17
gardencentreedinburghretailemployee-ownedtearoom+4 more
WordPressGeneratePress themejQueryGoogle reCAPTCHA+1
2026-07-05T07:03:44.709Z
express-exports.co.uk favicon

Express Export Services

express-exports.co.uk

52
TransportationUnited KingdomsmallMEDIUM

Express Export Services Limited is a UK-based international shipping and logistics company with over 50 years of experience. The company offers a broad range of services including parcel delivery, pallet and crate shipping, container shipping, vehicle shipping, international removals, antiques and artwork shipping, oversized cargo handling, professional packing, and customs/documentation assistance. Their target audience includes individuals, families, and businesses requiring reliable and secure international shipping solutions. The website presents a professional and consistent brand image with clear navigation and comprehensive service descriptions. Technically, the website employs modern frontend technologies such as Bootstrap, jQuery, and Owl Carousel, ensuring good mobile responsiveness and user experience. The site uses Google reCAPTCHA to protect forms from spam. However, there is no evidence of advanced security headers or cookie consent mechanisms, which are important for GDPR compliance and security hardening. From a security perspective, the website is accessible without WAF or blocking mechanisms, but lacks several security best practices such as security headers and explicit incident response contacts. The WHOIS data for the domain is unavailable due to a domain registration error indicating the domain name contains too many parts and cannot be registered, which raises concerns about domain legitimacy and ownership consistency. Overall, the website is professional and functional with good content quality and business credibility. However, the domain registration anomaly and missing security headers reduce the overall trust score. Strategic improvements in domain registration verification, security header implementation, and privacy compliance are recommended to enhance trust and security posture.

27
70
60
100
2
35
53
internationalshippingfreightforwardinglogisticsparceldeliveryvehicleshipping+2 more
BootstrapjQueryjQuery bxSliderOwl Carousel+4
2026-07-04T07:19:50.891Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
odesa.co.uk favicon

Odesa Limited

odesa.co.uk

54
OtherUnited KingdomsmallMEDIUM

Odesa Limited is a well-established professional cleaning company based in Southwest London, with over 20 years of experience. The company specializes in cleaning services across multiple sectors including offices, schools, retail, and communal areas. Their market position is that of a trusted local expert with a strong client retention rate, supported by recognized certifications such as ISO 14001 and OHSAS 18001. The website reflects a professional business model focused on service delivery to local institutions and businesses. Technically, the website is built on WordPress and employs modern web technologies including Google reCAPTCHA for form security and ShortPixel for image optimization. Hosting is provided by Krystal Hosting Ltd, a reputable UK-based provider. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with room for improvement in loading speed and accessibility. From a security perspective, the site enforces HTTPS and includes a Content-Security-Policy header, which are positive indicators. However, additional security headers are missing, and there is no visible formal security or incident response policy. The absence of a cookie consent mechanism suggests partial GDPR compliance. No vulnerabilities or exposed sensitive data were detected, indicating a generally sound security posture. Overall, the website is professional, trustworthy, and well-aligned with the company's business claims. Strategic improvements in privacy compliance and security policy transparency would enhance the site's risk profile and user trust.

62
60
85
20
55
17
53
cleaningprofessionalserviceslondonofficecleaningretailcleaning+1 more
WordPressPHPjQueryGoogle reCAPTCHA+2
2026-07-04T07:12:59.884Z
islabikes.co.uk favicon

Islabikes

islabikes.co.uk

56
RetailUnited KingdomsmallMEDIUM

Islabikes is a specialized retailer focused on children's bicycles and genuine spare parts, operating primarily in the United Kingdom. The company has a strong market position as a leading brand in children's bikes, offering products such as the Cnoc starter bikes and the upcoming Rosetta gravel bike. Their business model centers on e-commerce sales supported by comprehensive customer service and safety recall management. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to parents and cycling enthusiasts. Technically, the website employs a modern technology stack including Google Tag Manager, Google reCAPTCHA, jQuery, FancyBox, and GSAP for animations. It demonstrates good mobile optimization, accessibility, and SEO practices. The site uses HTTPS with an excellent SSL configuration and implements cookie consent mechanisms compliant with GDPR. However, some security headers are missing, and no explicit security policy or incident response contact is published. From a security perspective, the site shows good practices such as HTTPS enforcement, spam protection via reCAPTCHA, and cookie consent management. No vulnerabilities or exposed sensitive data were detected in the HTML content. The WHOIS lookup failed due to querying an invalid domain format, but business legitimacy is supported by company registration details and consistent contact information. Overall, Islabikes presents a trustworthy and professional online presence with a solid security posture and privacy compliance. Strategic improvements include adding security headers, publishing a security policy, and correcting WHOIS domain queries to enhance trust and transparency.

60
47
85
20
45
2
68
bicycleschildrenretaile-commercecycling+4 more
Google Tag ManagerGoogle reCAPTCHAjQueryFancyBox+4
2026-07-03T07:26:38.915Z
moodys.com favicon

MOODY'S

moodys.com

79
FinanceUnited StatesenterpriseLOW

Moody's is a leading global provider of credit ratings, research, and data analytics for capital markets. The company serves a broad range of clients including banking, insurance, corporations, public sector organizations, and asset management professionals. Moody's offers a comprehensive suite of services such as credit ratings, investment research, compliance and third-party risk solutions, lending suites, business intelligence, and portfolio management. Their market position is strong as a trusted and established entity in the finance industry, supported by consistent branding and professional digital presence. Technically, Moody's website is built on modern frameworks including React and Adobe Experience Manager, with integrations of Adobe DTM, Google Tag Manager, and Marketo for marketing and analytics. The site demonstrates good mobile optimization, accessibility, and SEO practices, delivering a professional user experience. Security measures include HTTPS enforcement, Content Security Policy, and bot protection via reCAPTCHA, although additional security headers could enhance the posture further. The security posture is solid with no visible vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, indicating GDPR awareness. Contact information is clearly provided, including corporate emails and phone numbers, enhancing business credibility. However, the WHOIS data is unavailable, which is unusual for a major corporate domain and warrants further verification. Overall, Moody's website reflects a mature, secure, and professional digital asset aligned with its enterprise business model. Strategic recommendations include enhancing security headers, publishing explicit security policies and incident response information, and verifying WHOIS data to strengthen trust and transparency.

100
79
85
87
85
25
88
financecreditratingsriskmanagementinvestmentresearchanalytics+3 more
ReactAdobe Dynamic Tag ManagementVimeo Player APIGoogle reCAPTCHA+2
2026-07-03T07:24:52.152Z
dbfs.co.uk favicon

DBFS

dbfs.co.uk

65
TechnologyUnited KingdommediumMEDIUM

DBFS is a professional consultancy and advisory firm specializing in finance, technology, and IT solutions. The company offers a broad range of services including Salesforce outsourcing, regulatory consulting, knowledge management, and recruitment. Positioned as a leading global provider, DBFS targets businesses in financial and technological sectors, supported by a parent company, AMAN GROUP. The website reflects a mature digital presence with clear branding and comprehensive service descriptions. Technically, the website is built on WordPress using Elementor and Yoast SEO, with modern JavaScript libraries such as jQuery and Slick Carousel. Security measures include HTTPS, Google reCAPTCHA, and Cloudflare Turnstile for form protection, indicating a good security posture. However, some security headers are not explicitly detected, and no dedicated security or incident response pages are found. The WHOIS data is incomplete and indicates domain registration issues with Nominet UK, which may be due to the domain being a subdomain or alias. Despite this, the website content and business information appear legitimate and professional. Contact information is complete and includes a physical address in London and a verified phone number. Overall, DBFS demonstrates a solid business and technical foundation with room for improvement in security transparency and WHOIS registration clarity.

75
65
52
100
75
68
2
financetechnologyconsultingsalesforcerecruitment+1 more
WordPressYoast SEO pluginjQuerySlick Carousel+2

Partner Domains:

aman-group.com
parent
2026-07-03T07:24:40.912Z
fletchersengineering.co.uk favicon

Fletchers Engineering

fletchersengineering.co.uk

47
ManufacturingUnited KingdommediumHIGH

Fletchers Engineering is a well-established UK-based engineering company specializing in HVAC fabrication, installation, and maintenance services. With over 30 years of industry experience, the company serves a diverse range of sectors including energy, manufacturing, hospitality, and government. Their website reflects a professional and comprehensive presentation of their services, supported by multiple industry accreditations and certifications, positioning them as a reputable player in their market segment. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Slick Slider, and integrates key tools like Google Analytics, Hotjar, and Google reCAPTCHA for analytics and security. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms, indicating a mature digital presence. However, some improvements in accessibility and security headers could enhance the technical posture. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security policies and incident response information. The WHOIS data is unavailable due to a query on the subdomain rather than the registered domain, which slightly reduces trustworthiness from a domain registration standpoint. Overall, the security posture is good but could benefit from additional transparency and technical hardening. The overall risk assessment is moderate-low, with the main concerns being the incomplete WHOIS data and absence of published security policies. Strategic recommendations include verifying domain registration details, implementing security.txt and incident response pages, and enhancing HTTP security headers to improve trust and compliance.

20
80
25
2
60
40
67
hvacengineeringfabricationmaintenanceuk+4 more
WordPressjQuerySlick SliderGoogle reCAPTCHA+4
2026-07-03T07:14:36.022Z
samltd.co.uk favicon

Sands Agricultural Machinery

samltd.co.uk

62
ManufacturingUnited KingdomsmallMEDIUM

Sands Agricultural Machinery is a UK-based family-run manufacturer specializing in self-propelled agricultural sprayers with tank capacities ranging from 3,000L to 6,000L. The company emphasizes durable UK-built machinery, practical design, and trusted customer support. Their market position is that of a niche manufacturer serving farmers and agricultural businesses, with a focus on quality and personal service. The website reflects this with detailed product information, customer testimonials, and clear contact options. Technically, the website is built on the Webflow platform, leveraging modern web technologies including Google Tag Manager, Google reCAPTCHA, and Finsweet cookie consent tools. The site is mobile-optimized and performs moderately well, with good SEO and accessibility basics. Security posture is solid with HTTPS enforced and use of CAPTCHA on forms, though explicit security headers and published security policies are lacking. The WHOIS data for the domain is incomplete and indicates a domain naming rule violation, suggesting the domain may be a subdomain or alias rather than a fully registered domain. Despite this, the website content and business information appear legitimate and professional. Privacy and cookie policies are comprehensive and GDPR compliant, with active consent mechanisms. Overall, the site presents a trustworthy and professional front for a small UK manufacturing business, though improvements in domain registration transparency and security policy publication are recommended.

70
70
100
54
88
2
30
agriculturalmachineryselfpropelledsprayersukmanufacturerfamilybusinessagriculture+1 more
WebflowGoogle Tag ManagerGoogle reCAPTCHAjQuery+3
2026-07-03T07:13:28.292Z