Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157333
Websites
130
Industries
113
Countries
52
Avg Score
Page 363 of 1003|Showing 18101-18150 of 50114
coursebox.ai favicon

Coursebox Pty Ltd.

coursebox.ai

65
EducationAustraliasmallMEDIUM

Coursebox Pty Ltd. operates www.coursebox.ai, an AI-powered SaaS platform specializing in rapid online course creation and learning management solutions. The company targets training providers, educators, and creators across multiple sectors including healthcare, agriculture, sales, and technology. Their platform offers AI-driven tools such as video generation, quiz creation, chatbot tutors, and white-label LMS capabilities, positioning them as a leading innovator in the eLearning space with a strong user base and positive market reputation. Technically, the website is built on modern web technologies including Webflow CMS, jQuery, and integrates advanced analytics and marketing tools like PostHog, Chargebee, and FirstPromoter. The site is well-optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. Security practices include HTTPS enforcement and secure form handling, though explicit security headers and cookie consent mechanisms could be improved. From a security perspective, the site demonstrates a solid posture with no visible vulnerabilities or exposed sensitive data. However, the absence of WHOIS transparency limits domain ownership verification. Privacy policies are comprehensive and GDPR compliant, but cookie consent and incident response information are lacking. Overall, the risk profile is moderate with recommendations to enhance security headers, privacy compliance, and transparency. Strategically, Coursebox is well-positioned in the education technology market with a clear value proposition and growing customer base. Continued focus on security, compliance, and user trust will support sustainable growth and market leadership.

60
53
2
75
72
75
100
aieducationcoursecreatortrainingsaas+4 more
Webflow CMSjQueryYouTube iframe APIChargebee (subscription management)+3

Partner Domains:

my.coursebox.ai
service
courseboxptyltd.freshdesk.com
service
2025-10-12T17:50:11.698Z
estewartandassociates.com favicon

E. Stewart & Associates

estewartandassociates.com

37
OtherUnited StatessmallHIGH

E. Stewart & Associates is a specialized fire prevention company operating primarily in Southern California, with over 30 years of experience. The company offers a range of environmental and fire prevention services including weed abatement, brush clearing, native habitat restoration, erosion control, and trail maintenance. Their clientele includes multiple municipalities, indicating a strong regional presence and trusted service provider status. The website reflects a professional and consistent brand image with clear contact information and service descriptions. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Flickity carousel, GSAP animations, and Vimeo for media integration. It is hosted by DreamHost, LLC, and uses HTTPS with a valid SSL certificate, ensuring secure communications. The site is moderately optimized for performance and mobile responsiveness, with good SEO practices evident in meta tags and structured data. From a security perspective, the site has a solid foundation with HTTPS and domain transfer protections but lacks advanced security headers and DNSSEC. There is no visible privacy policy or cookie consent mechanism, which presents compliance risks, especially under GDPR. No incident response or vulnerability disclosure information is provided, limiting transparency in security practices. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security hardening to reduce risk and improve user trust. Strategic improvements in these areas would elevate the site's security posture and regulatory adherence.

15
50
17
40
-
75
20
firepreventionweedabatementbrushclearingcaliforniaenvironmentalservices+1 more
WordPressPHPjQueryFlickity carousel+3
2025-10-12T16:42:09.064Z
variablefontcourse.com favicon

Variable Font Course p/a Studio Dahm

variablefontcourse.com

43
EducationNetherlandssmallHIGH

Variable Font Course is a specialized educational platform offering an 11-lesson video course on creating and implementing variable color fonts, led by instructor Arthur Reinders Folmer of Typearture. The business operates under Studio Dahm, based in the Netherlands, targeting graphic designers, typographers, and creative coders globally. The website demonstrates a professional and consistent brand presence with rich content, testimonials, and structured FAQ, positioning itself as a niche leader in typography education. Technically, the site is built on WordPress with BuddyBoss and LearnDash LMS, integrating WooCommerce for e-commerce functionality. It uses modern web technologies and embeds Vimeo for video content, providing a good user experience with mobile optimization and SEO best practices. Security posture is solid with HTTPS and secure payment gateways, though it lacks some security headers and formal security policies. Privacy compliance is partial, missing explicit privacy and cookie policies, which is a notable gap. WHOIS data is unavailable, reducing domain trustworthiness, but the site content and business information are consistent and credible. Overall, the site scores well on content quality and business credibility but should improve privacy compliance and domain transparency.

30
35
2
60
42
80
20
educationvariablefontstypographyonlinecoursefontdesign
WordPressBuddyBoss PlatformWooCommerceLearnDash LMS+2

Partner Domains:

glyphsapp.com
partner
affinity.serif.com
partner

+2 more partners

2025-10-12T16:39:03.125Z
rmkinjurylaw.com favicon

The Law Office of Richard M. Kenny

rmkinjurylaw.com

70
OtherUnited StatessmallMEDIUM

The Law Office of Richard M. Kenny is a small, highly specialized personal injury law firm based in New York City, serving clients across multiple boroughs including Manhattan, Bronx, Brooklyn, Queens, and Nassau County. The firm emphasizes a client-focused approach with a strong track record of over $500 million recovered and more than 5,000 cases prepared for trial. Their services cover a broad range of personal injury and medical malpractice claims, positioning them as a top-rated legal service provider in the NYC market. Technically, the website is built on WordPress with modern plugins such as Gravity Forms for client intake and Yoast SEO for search optimization. The site demonstrates good mobile responsiveness, accessibility, and SEO practices. Security is well implemented with HTTPS and multiple security headers, though the absence of a visible cookie consent mechanism suggests room for improvement in privacy compliance. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to privacy protection slightly reduces transparency but is common for legal firms. Overall, the site is professional, trustworthy, and well-maintained, supporting the firm's market position. Strategically, the firm should enhance privacy compliance by implementing a cookie consent banner and consider publishing explicit security and incident response policies to further build client trust and meet regulatory requirements.

65
68
17
75
75
75
100
personalinjurylawyernyclegalservicesmedicalmalpractice+2 more
WordPressGravity FormsjQueryOwl Carousel+3
2025-10-12T15:34:51.341Z
egochi.com favicon

Egochi Digital Marketing Agency

egochi.com

62
TechnologyUnited StatesmediumMEDIUM

Egochi Digital Marketing Agency is a professional, award-winning digital marketing firm specializing in SEO, PPC, content marketing, social media marketing, web design, and online reputation management. The company positions itself as a data-driven, client-focused agency delivering measurable results and sustainable growth for businesses. Their market presence is supported by multiple certifications and strong client testimonials, indicating a reputable and established business. Technically, the website is built on WordPress with modern plugins and tools such as Yoast SEO, Google Analytics, and Contact Form 7. The site is well-structured, mobile-optimized, and uses HTTPS, but lacks some advanced security headers and explicit privacy/cookie policies. The contact form includes CAPTCHA to mitigate spam. Security posture is generally good with HTTPS and no visible vulnerabilities, but the absence of security headers and a published security policy reduces the overall security maturity. The missing WHOIS registration data is a notable anomaly that requires further investigation to confirm domain legitimacy. Overall, the website is professional and trustworthy from a business and content perspective, but improvements in privacy compliance and security best practices are recommended to enhance trust and regulatory adherence.

20
53
17
75
75
75
100
digitalmarketingseoppccontentmarketingsocialmedia+4 more
WordPress CMSYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+5
2025-10-12T15:33:56.176Z
davidhardawaylaw.com favicon

The Law Offices of David C. Hardaway

davidhardawaylaw.com

48
OtherUnited StatessmallHIGH

The Law Offices of David C. Hardaway is a specialized criminal defense law firm based in San Marcos, Texas, serving clients primarily in Hays County and surrounding Central Texas areas. The firm offers comprehensive legal defense services including DWI, drug crimes, violent crimes, and other serious criminal charges. The website is professionally designed with rich content, detailed FAQs, attorney profiles, case results, and client testimonials, positioning the firm as a reputable and trusted legal service provider in the region. The firm holds multiple industry recognitions and certifications, enhancing its market credibility. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Swiper.js, and uses Google Fonts and Google Tag Manager for analytics and tracking. The site employs HTTPS with good SSL configuration and includes spam protection via Google reCAPTCHA on its contact form. However, it lacks visible security headers and cookie consent mechanisms, which are recommended for improved security and privacy compliance. From a security perspective, the site shows good practices like HTTPS enforcement and no exposed sensitive data, but the absence of WHOIS data for the domain raises concerns about domain registration legitimacy. Despite this, the website content and structure strongly indicate a legitimate business operation. Overall, the site scores well on content quality, business credibility, and technical implementation but should address privacy compliance and security header improvements. Strategically, the firm should verify domain registration details, implement comprehensive privacy and cookie policies with consent mechanisms, and enhance security headers to strengthen trust and compliance. These improvements will support the firm's professional image and reduce potential risks related to privacy and security.

15
53
17
70
72
75
-
lawfirmcriminaldefensedwilawyersanmarcostexas+4 more
WordPressjQuerySwiper.jsGoogle Fonts+5

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:46.044Z
mrlevelhead.com favicon

Mr. Level Head

mrlevelhead.com

49
OtherUnited StatessmallHIGH

Mr. Level Head is a small, local handyman and home repair service provider based in Spring Hill, Florida, serving Hernando and Pasco counties. The company offers a wide range of home repair services including door repair, electrical work, painting, drywall repair, furniture assembly, plumbing, and more. The website positions the business as reliable and detail-oriented, supported by multiple positive customer testimonials and local business listings such as BBB and Yelp. The business model is straightforward, charging by the job with flexible scheduling and a one-year labor warranty, targeting homeowners and residents in the local area. Technically, the website is built on WordPress using the Elementor page builder and related plugins, leveraging modern web technologies such as jQuery, Font Awesome, and Google Fonts. The site is hosted likely via GoDaddy, with a moderate performance profile and good mobile optimization. SEO is well addressed with proper meta tags, structured data (JSON-LD), and clear navigation. However, accessibility is basic and could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and DNSSEC. No privacy or cookie policies are present, indicating compliance gaps especially regarding GDPR. There is no visible incident response or vulnerability disclosure information. Analytics and tracking are implemented via Google Analytics, Ahrefs, and StatCounter, with moderate user tracking levels but limited privacy transparency. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and clearer policies to strengthen user trust and regulatory adherence.

15
35
17
55
72
80
40
handymanhomerepairlocalbusinessspringhillflhomeservices+1 more
WordPressElementorElementor ProjQuery+3
2025-10-12T15:32:50.656Z
appshot.gallery favicon

APPSHOT.GALLERY: App Store Screenshot Inspiration for ASO & Mobile UI

appshot.gallery

61
TechnologyN/asmallMEDIUM

AppShot Gallery is a specialized online platform providing a curated collection of mobile app screenshots aimed at helping developers, designers, and indie makers improve their App Store Optimization (ASO) and mobile UI design. The website positions itself as a niche resource for app screenshot inspiration, offering filtering by genre, tone, style, color, and font style, along with a submission feature and a preview tool. The business model revolves around providing inspiration and optimization resources rather than direct sales or services. Technically, the site is built on Webflow CMS, leveraging modern web technologies including jQuery, Google Fonts, and Finsweet attributes for CMS filtering and nesting. It uses Cloudflare Turnstile captcha for form protection and Plausible Analytics for privacy-friendly user tracking. The site is hosted likely on Webflow's infrastructure, with moderate performance and good mobile optimization. From a security perspective, the site enforces HTTPS and uses captcha to mitigate spam. However, it lacks explicit security headers and does not publish privacy, cookie, or terms of service policies, which are important for compliance and user trust. No WHOIS data is available due to malformed WHOIS responses, which slightly reduces trustworthiness but no suspicious patterns are detected. Overall, the site is professionally designed and functional, with good content quality and technical implementation. Strategic recommendations include publishing privacy and cookie policies, adding security headers, improving accessibility, and providing vulnerability disclosure information to enhance trust and compliance.

60
53
2
60
52
80
100
appstorescreenshotsasomobileuiappinspirationappgallery+1 more
WebflowjQueryGoogle FontsCloudflare Turnstile Captcha+1
2025-10-12T15:27:59.786Z
digitaldnalabs.ai favicon

Digital DNA Labs

digitaldnalabs.ai

59
TechnologyN/amediumMEDIUM

Digital DNA Labs is a technology company specializing in AI-powered solutions aimed at enhancing human potential and democratizing artificial intelligence. Their offerings include AI Agents, automation tools, and AI-driven applications across education, healthcare, and enterprise sectors. The company positions itself as an innovator focused on accessible AI technology for businesses and individuals worldwide. The website demonstrates a professional and consistent brand presence with rich multimedia content and references to reputable media outlets, indicating a strong market presence. Technically, the website is built on the Webflow platform, utilizing modern web technologies such as Google Tag Manager, Google Analytics, and reCAPTCHA for security and analytics. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features could be improved to enhance compliance and user experience. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks visible security headers and explicit privacy or cookie policies, which are important for compliance with regulations like GDPR. The absence of WHOIS data transparency slightly reduces trustworthiness, although the website content and branding suggest legitimacy. Overall, the site presents a solid digital presence with room for improvement in privacy compliance and security best practices. Strategic recommendations include implementing comprehensive privacy and cookie policies, enhancing security headers, and providing clear incident response and vulnerability disclosure information to strengthen trust and compliance.

30
35
17
70
62
75
100
aitechnologyinnovationdigitaldnaartificialintelligence+2 more
Google Tag ManagerGoogle AnalyticsGoogle reCAPTCHAWebflow CMS+2
2025-10-12T14:24:56.329Z