Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 256 of 408|Showing 12751-12800 of 20394
forsythbarrstadium.co.nz favicon

Forsyth Barr Stadium

forsythbarrstadium.co.nz

60
HospitalityNew ZealandmediumMEDIUM

Forsyth Barr Stadium is a prominent event venue located in Dunedin, New Zealand, known for hosting a wide range of sports, concerts, conferences, and community events. The stadium offers unique features such as a real grass field under a transparent roof and provides services including venue hire, membership programs, and hospitality. The website reflects a well-established business with a domain age since 2009, consistent with its market presence. Technically, the website is built on the SilverStripe CMS platform and leverages modern web technologies including Bootstrap, jQuery, and Font Awesome. It integrates multiple analytics and tracking tools such as Google Analytics, Facebook Pixel, and Hotjar, indicating a mature digital marketing approach. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. From a security perspective, the website uses HTTPS and Cloudflare for DNS and CDN services, but lacks DNSSEC and explicit security headers, which are recommended to enhance security posture. Privacy compliance is partial, with a privacy policy present but no visible cookie consent mechanism, which could be improved to meet GDPR standards fully. No incident response or vulnerability disclosure information is provided. Overall, Forsyth Barr Stadium's website is credible, professionally maintained, and serves its business purpose effectively. Strategic improvements in security headers, DNSSEC, and privacy compliance would further strengthen its security and trustworthiness.

50
53
2
60
65
65
100
eventvenuestadiumnewzealandsportsconcerts+2 more
HTML5CSS3JavaScriptjQuery+7
2025-07-07T07:54:20.933Z
frbservices.org favicon

Federal Reserve Banks

frbservices.org

73
FinanceUnited StatesenterpriseMEDIUM

The Federal Reserve Financial Services website represents the official online presence of the Federal Reserve Banks' financial services division. It provides comprehensive information and access to a wide range of financial services targeted primarily at depository institutions and banks. The site highlights key services such as electronic fund transfers, check collection, cash and coin distribution, and newer offerings like the FedNow Service. The Federal Reserve Banks hold a dominant market position as the central banking authority in the United States, and this website serves as a critical resource for their institutional customers. Technically, the website employs a modern technology stack including Bootstrap for responsive design, jQuery, and integrates multiple analytics tools such as Google Analytics and LinkedIn Insight Tag. The site is mobile-optimized and accessible, with good SEO practices evident in meta tags and structured navigation. Hosting and DNS services are provided by reputable providers, and the domain is well-established with a creation date in 1998. From a security perspective, the site enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, it lacks DNSSEC and certain security headers that could enhance protection. There is no publicly available security policy or incident response information, nor a vulnerability disclosure program. Privacy compliance is basic, with a clear privacy policy but no cookie consent mechanism detected. The use of privacy protection in WHOIS is justified given the nature of the organization. Overall, the website is professional, trustworthy, and well-maintained, with a strong business credibility score. Recommendations include enabling DNSSEC, adding security headers, publishing security policies, and implementing a vulnerability disclosure mechanism to further strengthen security posture and compliance.

80
53
10
70
100
85
100
federalreservefinancialservicesbankingfedwirefedach+4 more
Google AnalyticsGoogle Tag ManagerjQueryBootstrap+2
2025-07-07T07:51:05.396Z
tglyr.co favicon

Taglayer

tglyr.co

66
TechnologyBelgiumsmallMEDIUM

Taglayer is a technology company specializing in AI-driven personalization platforms designed to enhance customer experiences across multiple channels. Their SaaS offering enables businesses to gain deep customer insights, automate workflows, and optimize engagement through omnichannel messaging and performance tracking. Positioned as an all-in-one solution, Taglayer targets businesses seeking to boost conversions and customer loyalty through personalized interactions. The company is based in Belgium and has been operational since 2015. Technically, the website employs modern technologies including Vue.js and Cloudflare DNS services, ensuring fast performance and excellent mobile optimization. The site is well-structured with comprehensive content, clear navigation, and professional design. Analytics and marketing tools such as Ahrefs Analytics and DoubleClick are used for tracking and advertising purposes, with moderate user tracking levels and good privacy compliance. From a security perspective, the website enforces HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled, and some recommended security headers are missing. There is no publicly available incident response contact or vulnerability disclosure policy, which could be improved. Overall, the security posture is solid but could benefit from additional hardening. The overall risk assessment is low, with no signs of malicious activity or suspicious domain registration patterns. Strategic recommendations include enabling DNSSEC, publishing an incident response contact, and implementing a vulnerability disclosure policy to enhance trust and security culture. The website demonstrates a high level of professionalism, trustworthiness, and technical maturity suitable for its business domain.

15
68
17
85
75
85
100
aipersonalizationcustomerexperiencesaasmarketingautomation+1 more
JavaScriptVue.jsCloudflare DNSHTML5+1
2025-07-07T07:50:20.230Z
agency8.nl favicon

Agency8 Internet en Marketing Bureau

agency8.nl

64
TechnologyNetherlandssmallMEDIUM

Agency8 Internet en Marketing Bureau is a Dutch digital agency specializing in the development of websites, webshops, custom web applications, and digital marketing services. Founded in 2018, the company positions itself as a trusted digital partner focused on delivering quality, user-friendly, and maintainable online solutions tailored to client needs. Their service portfolio includes strategy, hosting, and specialized Umbraco CMS development, targeting businesses seeking professional online presence and e-commerce capabilities. Technically, the website employs modern web technologies including Bootstrap, jQuery, and various JavaScript libraries, with a responsive design optimized for mobile devices. The presence of structured data and comprehensive meta tags indicates a mature approach to SEO and digital marketing. Hosting and domain registration are managed through Cronon GmbH, a reputable registrar. From a security perspective, the site enforces HTTPS and includes a Content-Security-Policy header, enhancing protection against common web threats. However, DNSSEC is not enabled, and some additional security headers could be implemented to strengthen the security posture. No explicit security policies or incident response contacts are published, which could be improved to enhance trust and compliance. Overall, the website is professional, trustworthy, and well-structured, with clear contact information and social media presence. The lack of cookie consent mechanisms and terms of service pages are minor gaps in privacy compliance. The domain registration data aligns well with the business claims, supporting legitimacy. The site is safe for general audiences with no adult or questionable content detected.

60
68
2
60
75
65
100
internetbureauwebsiteswebshopsmarketingumbraco+2 more
HTML5CSS3JavaScriptjQuery+6
2025-07-07T06:45:37.537Z
ppsk-kiosk.com favicon

PPSK-Kiosk

ppsk-kiosk.com

72
TechnologyNetherlandssmallMEDIUM

PPSK-Kiosk is a specialized technology company offering a secure guest Wi-Fi access solution that integrates with Extreme Networks' ExtremeCloud IQ platform. Their core product is an iPad app that enables visitors to generate unique Private Pre-Shared Keys (PPSK) for Wi-Fi access, enhancing security and user experience. The company operates a SaaS model with a remote dashboard for kiosk management and licensing. The website is professionally designed, mobile-optimized, and rich in content, targeting system administrators and businesses needing secure guest Wi-Fi solutions. Technically, the website uses modern web technologies including Tailwind CSS and Alpine.js, hosted behind Cloudflare DNS services. It employs Google Tag Manager and Leadinfo for analytics and tracking. The site is fast, accessible, and SEO-friendly, with clear navigation and multiple calls to action for trials and dashboard registration. Security posture is strong with HTTPS enforced and no exposed sensitive data. However, DNSSEC is not enabled and security headers are not explicitly detected, suggesting room for improvement. Privacy compliance is adequate with a privacy policy present and GDPR considerations addressed, though no cookie consent mechanism was found. Business credibility is high with clear contact information, social media presence, and trust signals such as GDPR compliance and integration with a reputable partner (Extreme Networks). Overall, PPSK-Kiosk presents a trustworthy and professional online presence with a solid technical foundation and a clear business focus on secure guest Wi-Fi access. Strategic improvements in security headers, DNSSEC, and cookie consent would further enhance their security and compliance posture.

80
65
17
75
75
80
100
wi-figuestaccessppskextremenetworkssecurewi-fi+4 more
HTML5CSS3JavaScriptAlpine.js (x-data directives)+3

Partner Domains:

bluey.dev
partner
extremenetworks.com
partner
2025-07-07T06:42:31.635Z
543websitedesign.co.nz favicon

543 Website Design

543websitedesign.co.nz

60
TechnologyNew ZealandsmallMEDIUM

543 Website Design is a small New Zealand-based professional web design and digital marketing agency founded in 2015. They offer affordable, high-quality website design, branding, SEO, social media management, and online advertising services targeting small businesses across New Zealand. Their business model includes both professional design services and a DIY website builder option, positioning them as a versatile and accessible provider in the NZ market. The website content is well-structured, professional, and rich with client testimonials and trust signals, reflecting a strong market presence and customer focus. Technically, the website leverages modern web technologies including JavaScript, service workers for PWA capabilities, and integrates multiple marketing and analytics tools such as Facebook Pixel, LinkedIn Insight Tag, Hotjar, and Google Tag Manager. The site is mobile-optimized, fast-loading, and SEO-friendly, indicating a mature digital infrastructure. However, explicit privacy and cookie policies are not found, which is a gap in compliance and user transparency. From a security perspective, the site uses HTTPS and employs service workers, but lacks visible security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data for the domain reduces trust slightly, though the website content and business information are consistent and credible. Overall, the site demonstrates a good security posture but would benefit from enhanced privacy compliance and security transparency. The overall risk assessment is moderate-low risk with recommendations to implement privacy and cookie policies, add security headers, publish incident response information, and verify domain registration details. These steps will improve trust, compliance, and security posture, supporting the company’s professional image and customer confidence.

65
35
17
40
75
65
100
webdesignnewzealandseobrandingdigitalmarketing+2 more
JavaScriptjQuerySVG graphicsHTML5+3
2025-07-07T06:39:51.349Z
appropo.io favicon

Appropo Limited

appropo.io

58
HospitalityNew ZealandsmallMEDIUM

Appropo Limited operates a specialized SaaS platform focused on the hospitality sector in New Zealand, offering online ordering, payments, loyalty programs, and customer segmentation tools. The company has an established market presence since 2014, serving over 200 cafes, bars, and restaurants. Their platform integrates with notable partners such as DoorDash, Mailchimp, Windcave, and Xero, enhancing their service ecosystem. The website reflects a professional and consistent brand image with good content quality and user experience tailored for hospitality businesses. Technically, the website employs modern web technologies including Alpine.js for interactivity and Google Analytics for user tracking. Hosting appears to be on AWS infrastructure, with DNS managed via AWS nameservers. The site is mobile optimized and SEO friendly, though accessibility features are basic. Security posture is adequate with HTTPS enforced and domain transfer protections in place, but lacks DNSSEC and security headers, which are recommended for enhanced protection. From a security and compliance perspective, the site lacks explicit privacy cookie consent mechanisms and terms of service documentation, which are important for GDPR and general privacy compliance. No incident response or vulnerability disclosure policies are publicly available. The WHOIS data is consistent with the business claims, showing a legitimate and stable domain registration. Overall, the risk profile is moderate with room for improvement in privacy compliance and security hardening. Strategically, Appropo should prioritize implementing cookie consent, publishing clear terms and security policies, enabling DNSSEC, and adding security headers to strengthen trust and compliance. These steps will enhance their security posture and align with regulatory expectations, supporting continued growth in the competitive hospitality technology market.

15
53
2
75
67
75
100
engagementanalyticscustomerloyaltybrand+5 more
HTML5CSS3JavaScriptGoogle Analytics+1

Partner Domains:

vouchers.appropo.io
service
mailchimp.com
partner

+3 more partners

2025-07-07T06:39:46.339Z
hirschlerlaw.com favicon

Hirschler Fleischer

hirschlerlaw.com

64
Real EstateUnited StatesmediumMEDIUM

Hirschler Fleischer is a professional law firm based in Virginia, providing a broad range of legal services with a focus on client success and complex legal issues. The firm positions itself as a national-caliber entity with a strong emphasis on partner involvement and business efficiency. Their website reflects a medium-sized firm with consistent branding and professional content aimed at business and individual clients seeking legal counsel. Technically, the website employs modern web standards including HTTPS, Google Tag Manager for analytics, and responsive design elements. While the site performs moderately well and offers good accessibility and SEO features, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site benefits from HTTPS and secure form practices but lacks visible security headers and a formal vulnerability disclosure policy. The absence of WHOIS data raises questions about domain registration legitimacy, although the professional presentation and external references support the firm's credibility. Overall, the site is safe, trustworthy, and suitable for general audiences. Strategically, the firm should address privacy compliance gaps, enhance security headers, and clarify domain registration details to strengthen trust and security posture.

40
53
17
70
72
80
100
lawfirmlegalservicesvirginiaprofessionalservicesbusinesslaw+1 more
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:33:17.250Z
irell.com favicon

Irell & Manella LLP

irell.com

64
OtherUnited StatesmediumMEDIUM

Irell & Manella LLP is a reputable law firm specializing in high-stakes business litigation, including patent litigation, securities fraud defense, and complex contract disputes. The firm is recognized for achieving exceptional client outcomes and holds ISO 27001 certification, underscoring its commitment to information security. The website presents a professional and well-structured digital presence targeting corporate clients and legal professionals. Technically, the website employs modern web technologies including Google Tag Manager for analytics and tracking, with good mobile optimization and accessibility features. The site uses HTTPS with an excellent SSL configuration, though security headers are not explicitly detected. Privacy compliance is strong with a comprehensive privacy policy and cookie consent mechanism. Security posture is solid, supported by ISO 27001 certification and secure website practices, but could be improved by adding visible security headers and publishing incident response or vulnerability disclosure information. The absence of WHOIS data is unusual but does not detract significantly from the site's legitimacy given the professional content and trust signals. Overall, the website is trustworthy, professional, and secure with minor areas for improvement in security transparency and contact information visibility.

40
53
17
65
72
80
100
lawfirmbusinesslitigationpatentlitigationiso27001legalservices
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:32:17.143Z
stinson.com favicon

Stinson LLP

stinson.com

68
OtherUnited StateslargeMEDIUM

Stinson LLP is a well-established law firm providing a broad range of legal services to individuals, privately held enterprises, national companies, and international public corporations. The firm emphasizes practical legal guidance, risk minimization, and opportunity realization, supported by a collaborative culture and extensive legal knowledge. Their market position is strong, with multiple office locations across the United States and recognition in legal rankings such as Chambers USA. The website reflects a professional and trustworthy brand with clear navigation and comprehensive content. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, uses web fonts for branding consistency, and implements HTTPS with good security practices. The site is mobile optimized and accessible, with cookie consent mechanisms in place indicating GDPR compliance awareness. However, some advanced security headers are missing, and no explicit security policy or incident response contact information is published. From a security perspective, the site demonstrates a solid posture with HTTPS enforced and secure form handling. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is notable but does not detract significantly from the site's legitimacy given the professional content and external trust signals. Overall, the site scores well on content quality, technical implementation, security, privacy compliance, and business credibility, making it a reliable and professional online presence for Stinson LLP.

55
68
17
65
72
85
100
lawfirmlegalservicesattorneysprofessionalservicesprivacypolicy+2 more
Google AnalyticsGoogle Tag ManagerWeb fonts (Brandon Grotesque, Freight Text Pro)JavaScript+2

Partner Domains:

paytrace.com
partner
firmseek.com
partner
2025-07-07T05:32:02.121Z
E

embuild.com

embuild.com

59
OtherN/asmallMEDIUM

The website embuild.com is currently a parked domain with no active business content or services. It displays a banner indicating the domain is for sale and monetizes traffic through Google Adsense advertising. The site lacks any meaningful business description, contact information, or security and privacy policies, indicating it is not currently used as an operational business website. The domain is registered since 2005 with GoDaddy Online Services Cayman Islands Ltd., a reputable registrar, but the registrant is the registrar itself, typical for parked domains. Technically, the site uses basic HTML5 and CSS3 with Google advertising scripts. There is no evidence of a CMS or advanced frameworks. The site is moderately optimized for mobile but lacks accessibility and SEO best practices. Security posture is minimal with no DNSSEC, no security headers, and no visible HTTPS enforcement details. Privacy compliance is poor with no cookie consent or GDPR indicators. Overall, the security posture is weak due to lack of security headers and DNSSEC, and the business credibility is low due to absence of contact or company information. The site is safe in terms of content, containing no adult or explicit material. The domain is legitimate but currently unused for active business purposes. Strategic recommendations include enabling DNSSEC, adding security headers, implementing privacy and cookie policies with consent mechanisms, and providing clear business contact information to improve trust and compliance.

25
53
2
65
95
85
100
domainparkingdomainforsaleadvertisinggoogleadsense
Google AdsenseGoogle Ad ServicesHTML5CSS3
2025-07-07T01:01:40.584Z
membershipworks.com favicon

MembershipWorks

membershipworks.com

68
Non-profitN/asmallMEDIUM

MembershipWorks is a specialized SaaS provider offering comprehensive membership management software tailored for chambers of commerce, associations, non-profits, and similar groups. Established in 2011 and operating under the parent company SourceFound, it serves over 10,000 customers with a suite of services including member directories, event management, billing, donations, and website integration plugins for popular platforms like WordPress, Squarespace, and Weebly. The website reflects a mature business with consistent branding, good content quality, and clear navigation aimed at its target audience. Technically, the website is built on WordPress with custom themes and uses modern web standards including HTML5 and CSS3. It is mobile-optimized and SEO-friendly, though some accessibility features could be improved. The site is served over HTTPS with no visible security vulnerabilities or exposed sensitive data. However, security headers are not explicitly detected, and no dedicated security or incident response policies are published on the site. From a security and compliance perspective, the site enforces HTTPS and provides privacy and cookie policies, indicating GDPR compliance. Contact information is clearly provided, including phone and email. No forms or tracking scripts were detected on the homepage, suggesting minimal user data collection at this entry point. The domain registration data is consistent with the business claims, supporting legitimacy and trustworthiness. Overall, MembershipWorks presents a professional, trustworthy, and functional online presence with a strong focus on its niche market. Strategic improvements in security headers, incident response transparency, and accessibility would further enhance its security posture and compliance standing.

45
68
17
80
67
85
100
membershipsoftwarenon-profitassociationschambersofcommerceeventmanagement+5 more
WordPressHTML5CSS3JavaScript
2025-07-07T00:57:59.859Z
intermundial.com favicon

Intermundial

intermundial.com

62
OtherSpainmediumMEDIUM

Intermundial is a Spanish insurance company specializing in travel and sports insurance, boasting 30 years of market experience. The company offers a range of insurance products including travel, sports, and accident insurance with 24/7 assistance. Their business model focuses on online sales and customer self-service, supported by a modern digital presence and integration with multiple social media platforms. The company targets travelers and sports enthusiasts primarily in Spain but with global coverage options. The website reflects a medium-sized enterprise with consistent branding and a professional online presence. Technically, the website employs modern web technologies including Google Tag Manager, Cookiebot for consent management, and Visual Website Optimizer for A/B testing and analytics. The site is mobile-optimized and SEO-friendly, although some accessibility features could be improved. Performance is moderate with room for optimization. The use of multiple third-party scripts indicates a mature digital marketing strategy. From a security perspective, the site uses HTTPS and has implemented cookie consent mechanisms, but lacks visible security headers and explicit security or incident response policies. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is not publicly accessible due to registry restrictions, which is typical for .es domains, but the website content and structured data indicate a legitimate and trustworthy business. Overall, Intermundial presents a solid online presence with good business credibility and moderate technical and security maturity. Strategic improvements in privacy policy visibility, security headers, and incident response transparency would enhance trust and compliance.

30
25
17
85
77
85
100
insurancetravelsportsonlinespain+2 more
Google Tag ManagerCookiebotVisual Website Optimizer (VWO)jQuery (implied by VWO scripts)+2
2025-07-06T23:52:33.133Z