Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149091
Websites
130
Industries
113
Countries
52
Avg Score
Page 15 of 18|Showing 701-750 of 873
zlick.it favicon

Zlick Ltd

zlick.it

49
TechnologyUnited KingdomsmallHIGH

Zlick Ltd operates a specialized paywall software service designed for WordPress subscription sites, targeting content creators, bloggers, podcasters, and media corporations. The company positions itself as an easy-to-use, high-conversion paywall solution that requires minimal technical setup, emphasizing a 10-minute integration and no need for developers. Their business model is subscription and transaction-based, with integrated CRM and analytics tools to help customers optimize monetization. The website reflects a professional and consistent brand image with clear messaging and trust indicators such as customer earnings and testimonials. Technically, the website is built on WordPress using Elementor and Yoast SEO, leveraging modern JavaScript libraries and Google Analytics for tracking. The site demonstrates good SEO optimization, mobile responsiveness, and moderate performance. Security best practices are observed with HTTPS enforcement and security headers, though some privacy compliance aspects like cookie consent are lacking. From a security perspective, the site shows a solid posture with no visible vulnerabilities or exposed sensitive data. However, it lacks explicit security policies and incident response information, which could be improved to enhance trust and compliance. The WHOIS data aligns well with the website's claims, showing consistent registration details and no privacy protection, supporting legitimacy. Overall, Zlick's website is a credible and professional platform with a strong business focus and good technical implementation. Enhancements in privacy compliance and security transparency would further strengthen its position and user trust.

80
28
17
80
62
20
20
paywallsubscriptionwordpresscontentmonetizationmedia+1 more
WordPressElementorYoast SEOjQuery+4

Partner Domains:

portal.zlickpaywall.com
service
demo.zlick.it
service
2025-06-25T17:07:51.732Z
nextcorr.co.uk favicon

NextCorr Ltd.

nextcorr.co.uk

57
TransportationUnited KingdomsmallMEDIUM

NextCorr Ltd. is a specialized company providing world leading protection technologies focused on active cathodic protection and marine growth prevention systems. With over 50 years of experience and certifications from EU, UK, and German regulatory bodies, NextCorr positions itself as a trusted supplier and service provider in the marine and transportation sectors. Their offerings include design, manufacture, supply, and technical support for corrosion protection and marine growth prevention solutions. The company targets shipping, industrial, and energy sectors requiring advanced protection technologies. Technically, the website is built on WordPress using the Enfold theme, enhanced with Yoast SEO and WP Rocket for performance optimization. The site is mobile optimized and demonstrates good SEO practices, although accessibility features are basic. The technical infrastructure is modern and well-maintained, with no visible vulnerabilities or exposed sensitive data. However, security headers are not explicitly detected, and there is no published security or incident response policy. From a security perspective, the site uses HTTPS with an excellent SSL configuration, but lacks explicit security policies and vulnerability disclosure mechanisms. Privacy compliance is partial, with a cookie consent mechanism present but no privacy or terms of service pages found. Contact information is clearly provided, enhancing business credibility. Overall, the site is professional and trustworthy but could improve compliance and security transparency. The overall risk assessment is moderate with recommendations to implement comprehensive privacy policies, security headers, and incident response disclosures to enhance trust and compliance. Technical modernization opportunities include improving accessibility and adding vulnerability disclosure channels.

15
50
17
80
62
55
100
corrosionmarinegrowthpreventioncathodicprotectionshippingmarinetechnology+2 more
WordPressEnfold ThemeYoast SEOjQuery+2
2025-06-25T02:31:47.458Z
F

Titulinis - Foodlevel

foodlevel.eu

54
RetailLithuaniasmallMEDIUM

Foodlevel is a Lithuanian-based company specializing in the supply and distribution of frozen, fresh, smoked, canned, culinary, and grocery food products primarily targeting the horeca and retail sectors within Lithuania. The company offers logistics and delivery services nationwide, positioning itself as a regional supplier with a focus on quality and customer service. The website content is professionally presented in Lithuanian with an English language option, indicating a focus on local and possibly international business clients. Technically, the website employs a modern JavaScript stack including jQuery, Swiper, Fancybox, and other libraries to provide a responsive and interactive user experience. The site is mobile-optimized and includes SEO best practices such as meta tags and Open Graph data. Cookie consent and privacy policies are implemented in compliance with GDPR, and Google Analytics is used for traffic analysis. However, no explicit CMS or hosting provider information is discernible. From a security perspective, the site uses HTTPS and includes Google ReCaptcha on forms to mitigate spam. Cookie consent mechanisms are in place, but security headers are not explicitly detected, and no public security or incident response policies are found. The WHOIS data is not publicly available due to EURid privacy restrictions, but the website's professional presentation and contact details support its legitimacy. No critical vulnerabilities or exposed sensitive data were identified. Overall, Foodlevel presents a credible and professional online presence suitable for its business model. Strategic improvements in security headers, incident response transparency, and accessibility could enhance its security posture and compliance standing.

80
25
2
85
77
85
-
foodfrozenproductslogisticslithuaniahoreca+1 more
jQueryFancyboxSwiperSelect2+3
2025-06-24T21:51:59.411Z
M

MV Supply

mvsupply.eu

51
ManufacturingLithuaniamediumMEDIUM

MV Supply is a Lithuanian company specializing in warehouse storage equipment and related services such as design, installation, periodic inspections, and sales of various shelving systems. With 17 years of experience and a portfolio of over 1000 completed projects across 17 countries, the company targets B2B clients requiring efficient and safe warehouse solutions. The website is professionally designed, mobile-optimized, and provides clear navigation and contact information, supporting its market position as a reliable regional player. Technically, the website employs modern JavaScript libraries including jQuery, Swiper, and Google reCAPTCHA for form protection. It uses HTTPS with a valid SSL certificate, cookie consent mechanisms, and basic SEO and accessibility features. However, some security headers are missing, and no explicit security or incident response policies are published. The security posture is solid with no visible vulnerabilities, but improvements could be made by adding security headers and publishing a vulnerability disclosure policy. Privacy compliance is good with GDPR-aligned cookie and privacy policies in Lithuanian. Contact information is available but lacks direct company email addresses. Overall, the website presents a trustworthy and professional front with moderate technical sophistication and good privacy practices. The lack of WHOIS data due to EURid privacy restrictions limits domain age and registrant verification, but the website content and contact details align with the claimed business and location.

80
40
2
70
62
75
-
warehousestorageshelvinglogisticsb2b+1 more
jQueryFancyboxSwiperSelect2+3
2025-06-24T21:51:13.962Z
F

FleetMaster

fleetmaster.lt

41
TransportationLithuaniamediumHIGH

FleetMaster is a Lithuanian-based company specializing in transport management systems, offering a comprehensive suite of solutions including transport monitoring, route optimization, fuel control, and driver management. The company emphasizes its 25 years of experience and a dedicated IT team of 25 specialists, positioning itself as a professional and established player in the transportation technology sector. The website is well-structured, multilingual, and provides clear contact information and service descriptions, targeting transport and logistics businesses. Technically, the website employs modern JavaScript libraries such as jQuery, Swiper, and Fancybox, integrates Google Analytics and Tag Manager for tracking, and uses Google Recaptcha for form security. The site is HTTPS secured and includes a cookie consent mechanism compliant with GDPR. However, no advanced security headers were detected, and no explicit security or incident response policies are published. From a security perspective, the site demonstrates good baseline practices including HTTPS and form protection, but lacks visible security headers and formal vulnerability disclosure mechanisms. The absence of WHOIS data due to query limits restricts full domain legitimacy verification, though the site content and contact details appear consistent and professional. Overall, FleetMaster presents a credible and functional digital presence with moderate technical maturity and good privacy compliance. Security posture can be improved by adding security headers, publishing security policies, and enhancing transparency around incident response and vulnerability disclosure.

20
25
2
70
62
75
-
transportfleetmanagementlogisticstransportmonitoringrouteoptimization+5 more
jQueryFancyboxSwiperGoogle Analytics+3

Partner Domains:

www.texus.lt
partner
api.latgrupe.lt
partner
2025-06-24T16:46:18.785Z
broproduction.eu favicon

BroProduction

broproduction.eu

51
MediaLithuaniasmallMEDIUM

BroProduction is a Lithuanian-based professional video production company specializing in advertising videos, TV commercials, 3D graphics, animation, and drone filming services. The company targets businesses and organizations seeking high-quality video content to promote their brands and products. Their website showcases a portfolio of client projects and integrates social media channels such as Vimeo, Facebook, Instagram, and YouTube to enhance their digital presence. The business operates primarily in the media sector with a small company size and a focus on creative video production services. Technically, the website is built on WordPress 4.9.26 using the Inspiro theme and WPZOOM framework, with additional plugins like Yoast SEO and Beaver Builder Lite. The site employs Google Analytics and Google Tag Manager for user tracking and analytics. While the site is mobile-optimized and SEO-friendly, it uses an outdated WordPress version which may expose it to security vulnerabilities. The site lacks modern security headers and explicit privacy or cookie policies, indicating gaps in compliance and security best practices. From a security perspective, the site benefits from HTTPS encryption but lacks important security headers and uses an outdated CMS version. No incident response or security policy information is provided, and there is no evidence of GDPR compliance mechanisms such as cookie consent banners. Contact information is clearly presented, but privacy compliance is weak. The domain registration data is consistent with the business location and nature, supporting legitimacy. Overall, BroProduction presents a professional and functional website with good content quality and business credibility. However, security and privacy compliance improvements are necessary to reduce risk and enhance trust. Strategic recommendations include updating the WordPress core, implementing security headers, adding privacy and cookie policies with consent mechanisms, and conducting regular security audits to maintain a strong security posture.

15
10
2
70
65
75
100
videoproductionmediaadvertisingfilm3danimation+1 more
WordPress 4.9.26Yoast SEO pluginBeaver Builder LitejQuery+3
2025-06-24T16:46:08.737Z
profinas.lt favicon

UAB Profinas

profinas.lt

44
FinanceLithuaniasmallHIGH

Profinas is a Lithuanian financial services company specializing in outsourced accounting, financial consulting, and legal assistance tailored to support business growth. The company positions itself as a personal financial department alternative, offering a three-step accounting system designed to provide comprehensive financial management at the cost of an average accountant. Their website reflects a professional and consistent brand image, targeting Lithuanian businesses seeking reliable financial support. Technically, the website is built on WordPress 4.9.24 with common libraries such as jQuery and MediaElement.js, and integrates Google Tag Manager and Google Analytics for tracking. The site is mobile optimized and uses HTTPS with a cookie consent mechanism, indicating a moderate level of digital maturity. However, the WordPress version is outdated, which could pose security risks. From a security perspective, the site enforces HTTPS and includes a cookie consent banner, but lacks advanced security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of WHOIS data limits domain trust verification, but the website content and contact information suggest a legitimate and established business. Overall, Profinas demonstrates a solid business presence with good content quality and privacy compliance. Strategic improvements in security headers, CMS updates, and transparency around security policies would enhance their security posture and trustworthiness.

15
25
2
85
67
85
-
financeaccountingconsultingbusinessserviceslithuania
WordPress 4.9.24jQuery 1.12.4Google Tag ManagerGoogle Analytics+2
2025-06-24T16:45:10.400Z
grynumberhealth.com favicon

GryNumber Health LLC

grynumberhealth.com

53
HealthcareN/asmallMEDIUM

GryNumber Health LLC is a European healthcare company specializing in delivering innovative diagnostic and treatment solutions to underserved markets. As part of the GryNumber Health Group, the company focuses on facilitating access to novel medical technologies and therapies across 25+ small and medium-sized European countries. Their core services include healthcare innovation delivery, diagnostics, therapeutics, and market access support for global pharma innovators. The website reflects a professional and consistent brand presence with clear messaging targeting healthcare providers and pharmaceutical companies operating in Europe. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Slider Revolution, leveraging Google Tag Manager for analytics and tracking. The site is mobile-optimized with good SEO and accessibility features, though some accessibility aspects could be improved. Performance is moderate, with external resources loaded from trusted CDNs. Security is enforced via HTTPS with domain transfer protections, but DNSSEC is not enabled and some security headers are missing. From a security perspective, the site demonstrates good baseline practices including GDPR-compliant cookie consent and privacy policies. However, it lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is consistent with the business claims, showing a domain age appropriate for the company’s history. Overall, GryNumber Health’s website presents a credible, professional, and secure digital presence suitable for its healthcare innovation business. Strategic improvements in security headers, DNSSEC, and published security policies would enhance trust and compliance further.

15
80
2
85
62
75
20
healthcarediagnosticspharmaceuticalinnovationeuropeanmarkets+3 more
WordPressYoast SEO pluginjQueryMediaElement.js+4
2025-06-24T16:45:04.251Z
U

UAB Audėjas

audejas.lt

52
ManufacturingLithuaniamediumMEDIUM

UAB Audėjas is a well-established Lithuanian textile manufacturer specializing in upholstery and decorative fabrics since 1946. The company maintains a modern web presence with an e-shop and showcases its participation in EU co-financed projects, reflecting a commitment to innovation and competitiveness. The website is professionally designed, mobile-optimized, and provides clear contact channels and privacy compliance features, including GDPR-aligned policies and cookie consent mechanisms. Technically, the site employs a modern JavaScript stack including jQuery, Swiper.js, and Google reCAPTCHA for form security. While HTTPS is enforced, the absence of explicit security headers such as CSP and HSTS suggests room for improvement in hardening the security posture. The site demonstrates good SEO and accessibility basics but could enhance accessibility features further. Security-wise, the use of Google reCAPTCHA and cookie consent indicates awareness of bot mitigation and privacy regulations. However, the lack of published security policies or incident response contacts limits transparency. The WHOIS data is unavailable due to query limits, which slightly reduces trust but is likely privacy protection rather than malicious concealment. Overall, the website presents a credible and professional business with moderate technical maturity and good privacy compliance. Strategic improvements in security headers, incident response transparency, and WHOIS data availability would enhance trust and security posture.

65
68
2
70
72
60
-
textilesmanufacturingupholsterydecorativefabricseuprojects+3 more
jQuerySwiper.jsSelect2AOS (Animate On Scroll)+3
2025-06-24T16:45:03.898Z
privatuscare.com favicon

Privatus Care Solutions

privatuscare.com

57
HealthcareUnited StatesmediumMEDIUM

Privatus Care Solutions is a private nursing and home care service provider operating primarily in New England, New York, and Palm Beach, Florida. Established since 2005, the company offers a range of specialized healthcare services including post-operative care, dementia care, end-of-life care, medical escorts, and travel nursing. Their business model focuses on concierge-level, client-centered care managed by experienced registered nurses and senior managers. The website reflects a medium-sized healthcare business with a professional online presence and a clear focus on personalized home healthcare services. Technically, the website is built on WordPress with common plugins such as Yoast SEO and jQuery libraries. The site is moderately optimized for performance and mobile responsiveness, with good SEO practices evident through meta tags and structured data. However, accessibility features are basic, and there is room for improvement in security headers and cookie consent mechanisms. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, the absence of security headers and a formal incident response or security policy page indicates moderate security maturity. The missing WHOIS data for the domain raises some concerns about domain registration transparency, which slightly impacts trustworthiness despite the professional appearance and social media presence. Overall, Privatus Care Solutions presents a credible and professional healthcare service website with good content quality and business credibility. Strategic improvements in privacy compliance, security headers, and domain transparency would enhance their security posture and trustworthiness further.

30
53
2
70
52
75
100
healthcareprivatenursinghomecarebostonnewyork+4 more
WordPressYoast SEOjQueryMediaElement.js
2025-06-24T16:45:00.410Z
asc-aqua.org favicon

Aquaculture Stewardship Council

asc-aqua.org

70
OtherN/amediumMEDIUM

The Aquaculture Stewardship Council (ASC) is a globally recognized non-profit organization dedicated to promoting responsible seafood farming through certification programs and sustainability standards. Their website serves multiple audiences including seafood consumers, producers, and business partners, providing comprehensive information about certification, impact, and engagement opportunities. The organization holds a strong market position as a leader in sustainable aquaculture certification with a medium-sized operational scale and a founding date consistent with domain registration in 2011. Technically, the website is built on a modern WordPress platform enhanced with React components and optimized for performance using WP Rocket. It employs various third-party tools such as Google Tag Manager and Visual Website Optimizer for analytics and marketing. The site demonstrates excellent design quality, mobile responsiveness, and SEO optimization, reflecting a mature digital presence. From a security perspective, the site enforces HTTPS and uses domain registration protections but lacks explicit security headers and published security policies or incident response contacts. No critical vulnerabilities or suspicious patterns were detected. Privacy compliance is partial, with a cookie consent mechanism present but no clear privacy policy page found in the provided content. Overall, the website is professional, trustworthy, and well-positioned in its sector but would benefit from enhanced transparency in privacy and security policies to improve compliance and user trust.

80
80
2
75
57
80
100
aquacultureseafoodsustainabilitycertificationnon-profit+2 more
WordPress 6.8.1jQueryReactLodash+5

Partner Domains:

be.asc-aqua.org
partner
cn.asc-aqua.org
partner

+3 more partners

2025-06-24T12:55:39.321Z
strandmeats.com favicon

Strand Palace Meats Ltd

strandmeats.com

39
RetailMaltasmallHIGH

Strand Palace Meats Ltd is a Malta-based company specializing in the import and export of meat and poultry products worldwide, with a focus on the European market. As a subdivision of Strand Palace Agencies, which has over 100 years of experience, the company leverages extensive supplier relationships globally to offer a wide range of products including beef, chicken, lamb, and pork. Their business model centers on sourcing quality products and providing competitive pricing to their clients. The website presents a professional image with clear product catalogues and contact information, targeting distributors and business partners in Europe. Technically, the website is built on WordPress 6.3 using WPBakery Page Builder and other modern web technologies. It is served over HTTPS with multimedia content and responsive design, providing a good user experience. However, some areas such as security headers and privacy compliance policies are lacking, which could be improved to enhance trust and regulatory adherence. From a security perspective, the site uses HTTPS and does not expose sensitive data or vulnerable libraries. Nonetheless, the absence of WHOIS registration data for the domain raises concerns about domain legitimacy and ownership transparency. No privacy or cookie policies were found, and no incident response or vulnerability disclosure information is provided, indicating gaps in compliance and security readiness. Overall, the website is functional and professional but would benefit from improved transparency in domain registration, enhanced security headers, and the addition of privacy and cookie policies to meet compliance standards and build greater trust with visitors and partners.

15
35
2
70
62
60
-
meatpoultrytradingmaltaimport+2 more
WordPress 6.3WPBakery Page BuilderLayerSliderjQuery 3.7.0+2
2025-06-24T09:30:12.636Z
johs-jensen.dk favicon

Johs. Jensen Fiske- & Muslingeeksport A/S

johs-jensen.dk

47
OtherDenmarksmallHIGH

Johs. Jensen Fiske- & Muslingeeksport A/S is a well-established Danish seafood exporter specializing in high-quality shellfish products sourced daily from Limfjorden. Founded in 1928, the company operates from Jegindø and maintains strong partnerships with local fishermen. Their product range includes blue mussels, line mussels, heart mussels, and lobsters, all certified for sustainability and organic standards. The website reflects a professional and consistent brand image with clear product and company information targeted at seafood buyers and distributors. Technically, the website is built on WordPress using the Enfold theme, incorporating modern web technologies such as jQuery, Google Fonts, and Google Maps API. The site is mobile-optimized and includes a cookie consent mechanism powered by Iubenda, demonstrating attention to privacy compliance. Performance is moderate, with room for improvement in accessibility and SEO. From a security perspective, the site uses HTTPS and a reputable cookie consent solution but lacks advanced security headers and DNSSEC. No incident response or vulnerability disclosure information is provided, which could be enhanced to improve security posture. The domain registration data aligns well with the company's history, supporting legitimacy. Overall, the website presents a trustworthy and professional digital presence with good privacy compliance and business credibility. Strategic improvements in security headers, incident response transparency, and technical performance could further strengthen the site’s security and user trust.

20
68
17
70
42
60
20
seafoodshellfishexportsustainabilitydenmark+5 more
WordPressEnfold ThemejQueryMediaElement.js+3

Partner Domains:

limfjordensfinest.dk
partner
2025-06-23T19:09:19.087Z
mitsubishi-motors-presse.fr favicon

M Motors Automobiles France

mitsubishi-motors-presse.fr

31
TransportationFrancemediumHIGH

Mitsubishi Motors Presse France operates an official press and media portal providing editorial content such as press releases, images, videos, and dossiers related to Mitsubishi Motors vehicles and corporate news. The site targets media professionals and journalists in France, serving as a trusted source for up-to-date information about Mitsubishi Motors' product lineup and corporate developments. The website is well-branded and consistent with Mitsubishi Motors' corporate identity, linking to official parent and partner sites. Technically, the site uses a mix of legacy and modern web technologies including jQuery 1.8.2, Google Analytics, and Dropbox API integrations. While the site is accessible over HTTPS and includes basic cookie consent mechanisms, it lacks explicit privacy and cookie policies and does not implement advanced security headers, which are recommended for improved security posture and compliance. The WHOIS data for the domain is unavailable, which slightly reduces trustworthiness but does not contradict the legitimacy of the site given the professional content and official branding. Overall, the site is functional, professional, and serves its purpose as a press resource effectively.

20
10
2
50
42
45
-
automotivepressmediamitsubishifrance+2 more
jQuery 1.8.2Google AnalyticsGoogle Tag ManagerDropbox API+4

Partner Domains:

www.mitsubishi-motors.fr
partner
www.mitsubishi-motors.com
parent
2025-06-23T11:07:18.660Z
hellotaste.ro favicon

Antena TV Group SA

hellotaste.ro

55
MediaRomanialargeMEDIUM

HelloTaste.ro is a Romanian culinary media website operated by Antena TV Group SA, a well-established media company with multiple TV channels and online platforms. The site offers a rich collection of recipes, cooking tips, interviews with chefs, and video content targeting Romanian-speaking audiences interested in gastronomy. The business model is primarily content publishing supported by advertising revenue, leveraging a strong brand presence within the Antena Group ecosystem. Technically, the website is built on WordPress and employs modern web technologies including Google Analytics, Prebid.js for programmatic advertising, and OneSignal for push notifications. The site is hosted on AWS infrastructure, uses HTTPS with good SSL configuration, and implements GDPR-compliant consent management via CookiePro. The site is mobile-optimized and SEO-friendly, with structured data enhancing search engine visibility. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and consent-based tracking. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not evident and should be implemented to strengthen security posture. No critical vulnerabilities or exposed sensitive data were detected. Privacy policies and terms of service are clearly presented, supporting compliance with GDPR. Overall, HelloTaste.ro presents a professional, trustworthy, and well-maintained online presence with a solid business backing. Strategic improvements in security headers and ongoing monitoring of third-party scripts are recommended to maintain and enhance security and compliance.

15
25
17
70
72
60
100
mediaculinaryrecipesadvertisinggdpr+2 more
WordPress 6.8.1Google FontsGoogle Analytics (gtag.js)Prebid.js for header bidding+6

Partner Domains:

catine.ro
partner
a1.ro
partner

+3 more partners

2025-06-23T10:18:39.287Z
millistream.com favicon

Millistream AB

millistream.com

58
FinanceSwedenmediumMEDIUM

Millistream AB is a Sweden-based financial market data provider established in 2008, specializing in delivering real-time and historical market data, news, and corporate information from major global exchanges such as Nasdaq, NYSE, Deutsche Börse, and London Stock Exchange. The company targets financial institutions including banks, brokers, asset managers, and media companies, primarily in the Nordic region but with growing international reach. Their offerings include APIs, widgets, and a web-based trading application called Millistream Trader, designed to provide efficient and intuitive market views. Technically, the website is built on WordPress with the Enfold theme and leverages modern web technologies including jQuery, Google Analytics, and custom streaming APIs. The infrastructure supports low-latency data delivery via dedicated leased lines and cloud presence on AWS, indicating a mature and scalable technical setup. The site is mobile optimized and SEO friendly, though performance is moderate. From a security perspective, the site uses HTTPS and implements GDPR-compliant cookie consent mechanisms. However, it lacks publicly available privacy policies, terms of service, security policies, and incident response contacts, which are important for compliance and trust. No critical vulnerabilities or exposed sensitive data were detected, but security headers are not explicitly present, and no vulnerability disclosure policy is found. Overall, Millistream presents a professional and credible online presence with solid business and technical foundations. To enhance trust and compliance, it is recommended to publish comprehensive privacy and security policies, provide clear contact channels for security incidents, and implement additional security headers and disclosure mechanisms.

45
65
2
70
90
70
40
financialdatamarketdataapiwidgetstrader+2 more
WordPress 6.8.1Enfold Theme 4.5.7Yoast SEO pluginjQuery 3.7.1+4
2025-06-23T10:14:05.126Z
optimx.com favicon

OptimX Markets, Inc.

optimx.com

61
FinanceUnited StatessmallMEDIUM

OptimX Markets, Inc. operates a technology platform focused on institutional block trading, aiming to enhance transparency and simplify liquidity sourcing for large suppliers and consumers. The company positions itself as an innovator in the finance technology sector, targeting institutional traders with solutions that align incentives and foster relationship-based trading dynamics. The website content reflects a professional and consistent brand image, emphasizing their key services and market approach. Technically, the website is built on WordPress using the Enfold theme and Jetpack plugin, incorporating modern web technologies such as jQuery and MediaElement.js. The site includes embedded Vimeo video content and Google Fonts, and it is served over HTTPS with a valid SSL certificate. Performance and mobile optimization are moderate to good, though accessibility features are basic. SEO practices are adequately implemented with proper meta tags and Open Graph data. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and does not provide a published security policy or incident response information. No vulnerability disclosure or security.txt file is present. Privacy compliance is partial, with a privacy policy found under regulatory disclosures but no cookie consent mechanism or terms of service page. Contact information is limited to an email address with no phone or physical address provided. Overall, the website demonstrates a solid business credibility and technical foundation but would benefit from enhanced privacy compliance and security transparency. Strategic recommendations include implementing cookie consent, publishing security and incident response policies, adding vulnerability disclosure mechanisms, and improving accessibility to strengthen trust and compliance.

30
50
25
70
49
85
100
financeinstitutionaltradingtechnologyliquidityblocktrading
WordPressjQueryMediaElement.jsVimeo embedded video+1
2025-06-22T18:40:32.617Z