Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 117 of 162|Showing 5801-5850 of 8072
fileandservexpress.com favicon

File & ServeXpress

fileandservexpress.com

66
TechnologyUnited StatesmediumMEDIUM

File & ServeXpress is a well-established technology company specializing in eFiling and eService solutions for the legal community, including courts, government agencies, and law firms. With over 32 years of experience and a domain age of more than 12 years, FSX positions itself as a leader in providing comprehensive litigation workflow solutions including case management, document exchange, and notification tools. Their business model focuses on B2B SaaS offerings tailored to legal professionals, supported by a professional and content-rich website that clearly targets legal industry stakeholders. Technically, the website is built on a modern WordPress CMS platform using Elementor for design and layout, integrated with Yoast SEO for search optimization and Google Analytics for user tracking. Hosting is supported by Azure DNS infrastructure, and the site demonstrates good mobile optimization and accessibility features. The website performance is moderate, with a clean and professional design that supports user experience and navigation clarity. From a security perspective, FSX demonstrates a strong posture with HTTPS enforcement, SOC 2 Type II certification prominently displayed, and standard domain registration protections. However, there are areas for improvement such as enabling DNSSEC, implementing a Content-Security-Policy header, and publishing a security.txt file for vulnerability disclosure. No critical vulnerabilities or exposed sensitive data were detected, and the site does not employ a WAF or show signs of content blocking. Overall, FSX presents a trustworthy and professional online presence with solid business credibility and compliance indicators. The site is safe for general audiences, with no adult or questionable content. Strategic recommendations include enhancing DNS security, improving security headers, and formalizing vulnerability disclosure processes to further strengthen trust and security posture.

25
58
17
85
85
75
100
legalefilingeservicetechnologylaw+3 more
WordPress 6.8.1Elementor 3.29.1Yoast SEOGoogle Analytics (ExactMetrics plugin)+2
2025-07-07T17:01:02.141Z
phaboard.org favicon

Public Health Accreditation Board

phaboard.org

60
GovernmentUnited StatesmediumMEDIUM

The Public Health Accreditation Board (PHAB) operates as a leading non-profit organization dedicated to accrediting public health departments across the United States. Their website serves as a comprehensive resource for accreditation information, training, data insights, and consultation services, targeting government health agencies and public health professionals. The organization has a strong market position as the national standard for public health accreditation, supported by a domain age of over 15 years and consistent branding. Technically, the website is built on WordPress using the Avada theme and several plugins including Modern Events Calendar and Yoast SEO. It employs modern web technologies such as HTTPS, Google Tag Manager, and Cloudflare DNS, ensuring a secure and performant user experience. The site is mobile-optimized and accessible, with good SEO practices implemented. From a security perspective, the site demonstrates good practices including HTTPS enforcement, security headers, and no visible vulnerabilities or exposed sensitive data. However, it lacks a publicly available security policy, incident response information, and vulnerability disclosure mechanisms, which are recommended for enhanced trust and compliance. Overall, PHAB's website is professional, trustworthy, and well-aligned with its mission. Strategic recommendations include enabling DNSSEC, publishing security and incident response policies, and adding vulnerability disclosure information to further strengthen security posture and stakeholder confidence.

15
35
17
80
65
80
100
publichealthaccreditationgovernmentnon-profithealthdepartments+3 more
WordPressAvada ThemeModern Events Calendar pluginYoast SEO+2

Partner Domains:

phab.morevang.com
partner
selfbridgestration.custom-bridgeapp.com
partner

+2 more partners

2025-07-07T17:00:06.959Z
bowls.com.au favicon

Bowls Australia

bowls.com.au

62
OtherAustraliamediumMEDIUM

Bowls Australia is the national governing body for the sport of bowls in Australia, providing comprehensive support to clubs, players, officials, and the broader community. The organization manages national events, coaching programs, officiating standards, and community engagement initiatives, positioning itself as the authoritative entity for bowls in the country. The website reflects a mature digital presence with rich content, clear navigation, and active social media integration, targeting bowls enthusiasts and stakeholders across Australia. Technically, the website is built on WordPress with modern plugins and integrations such as Yoast SEO, Google Analytics, and social media tools. Hosting is managed via AWS DNS infrastructure, ensuring reliable performance. The site is mobile-optimized and accessible, with good SEO practices evident through structured data and meta tags. From a security perspective, the site enforces HTTPS with a valid SSL certificate and employs some security best practices, including sanitization of SVG content. However, it lacks certain security headers and a visible cookie consent mechanism, which are recommended for enhanced protection and compliance. No critical vulnerabilities or suspicious activities were detected. Overall, Bowls Australia’s website demonstrates a high level of professionalism, trustworthiness, and business credibility. Minor improvements in privacy compliance and security headers would further strengthen its posture. The domain registration data aligns well with the organization's profile, supporting legitimacy and trust.

15
53
17
80
72
70
100
sportsbowlsaustralianationalbodyevents+3 more
WordPressYoast SEOGoogle Analytics (MonsterInsights)jQuery+4

Partner Domains:

bowlstv.com.au
partner
bowlshub.clubmap.com.au
partner

+3 more partners

2025-07-07T15:58:14.870Z
circlecountry.com favicon

PowerNation Studios, LLC

circlecountry.com

60
MediaUnited StatesmediumMEDIUM

Circle Country is a media streaming platform specializing in country music and lifestyle entertainment, operated by PowerNation Studios, LLC. The website offers free streaming and on-demand content accessible via multiple popular streaming platforms. The business targets country music fans and lifestyle viewers, positioning itself as a niche media channel within the entertainment industry. The site is professionally designed with consistent branding and clear navigation, supporting a medium-sized business model focused on digital media distribution. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery, Video.js, and Slick Carousel. It leverages AWS Cloudfront CDN for hosting and delivers content with moderate performance and good mobile optimization. SEO is enhanced using the Yoast SEO plugin, and Google Analytics is employed for user tracking. However, accessibility features are basic, and some security best practices like security headers and cookie consent mechanisms are missing. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data in the HTML. Nonetheless, the absence of security headers and lack of published security or incident response policies indicate room for improvement. The WHOIS data is notably missing or unavailable, which raises concerns about domain registration legitimacy despite the active and professional website presence. Overall, the website presents a moderate risk profile with good business credibility but some technical and compliance gaps. Strategic improvements in security headers, privacy compliance, and WHOIS transparency would enhance trust and security posture.

15
53
2
85
67
80
100
countrymusicstreamingmediaentertainmentvideo+2 more
jQueryVideo.jsSlick CarouselYoast SEO
2025-07-07T15:53:03.307Z
careersourcencfl.com favicon

CareerSource North Central Florida

careersourcencfl.com

53
GovernmentUnited StatesmediumMEDIUM

CareerSource North Central Florida is a regional government workforce development organization providing career services, job placement, training, and business workforce solutions primarily for North Central Florida counties. The website serves job seekers and employers with resources, events, and support programs. The organization is positioned as a key regional player in workforce development with a medium-sized operational footprint and a focus on community impact. Technically, the website is built on WordPress with common libraries such as jQuery, Flickity, and Google Maps API. SEO is enhanced via Yoast SEO plugin, and Google Analytics is used for visitor tracking. The site is mobile optimized and has moderate performance. Hosting and domain registration are stable and consistent with the organization's profile. Security posture is adequate with HTTPS enabled and domain status protections, but lacks DNSSEC and security headers. No cookie consent mechanism or explicit security policies are published, indicating room for improvement in privacy compliance and incident response readiness. No critical vulnerabilities or suspicious indicators were found. Overall, the website is professional, trustworthy, and serves its intended audience well. Strategic improvements in security headers, DNSSEC, privacy compliance, and incident response transparency would enhance the security posture and trustworthiness further.

25
53
2
75
72
80
40
careerservicesworkforcedevelopmentjobsearchtrainingbusinessservices+2 more
jQueryFlickityGoogle Maps APIYoast SEO+2
2025-07-07T13:35:02.848Z
imaps-capital.com favicon

iMaps ETI AG

imaps-capital.com

57
FinanceSwitzerlandsmallMEDIUM

iMaps ETI AG is a Swiss-based financial services company specializing in the creation and issuance of Exchange Traded Instruments (ETIs), including Actively Managed Certificates (AMCs) and Fund-Linked Notes. The company targets financial institutions, asset managers, and investors seeking innovative investment products in the European market. Founded in 2018, iMaps ETI AG positions itself as a niche player offering white label solutions and a proprietary issuance platform to streamline ETI creation. The website infrastructure is built on WordPress with Elementor and Astra theme, leveraging modern web technologies and integrating marketing and analytics tools such as HubSpot and Google Ads. The site is multilingual, GDPR compliant, and features cookie consent mechanisms, reflecting a mature digital presence. Performance and mobile optimization are good, though some accessibility features could be enhanced. Security posture is solid with HTTPS enforced and no visible vulnerabilities, but there is room for improvement by enabling DNSSEC, adding security headers, and publishing formal security policies and incident response contacts. No critical security issues were detected. The WHOIS data aligns well with the business profile, indicating legitimacy and consistent domain registration. Overall, iMaps ETI AG demonstrates a professional and trustworthy online presence suitable for its financial services business, with recommendations to strengthen security transparency and technical safeguards to further enhance trust and compliance.

15
95
17
55
95
80
20
financeexchangetradedinstrumentsactivelymanagedcertificatesfundlinkednoteswhitelabelservices+4 more
WordPressElementorAstra ThemeYoast SEO+1
2025-07-07T13:32:47.310Z
bhn.org.au favicon

Better Health Network

bhn.org.au

63
HealthcareAustraliamediumMEDIUM

Better Health Network is a well-established non-profit healthcare provider based in Australia, specializing in primary health services and community wellbeing. The organization offers a broad range of services including mental health, dental, GP clinics, Indigenous health, and disability support under the NDIS scheme. Their market position is strong within the Melbourne region, supported by a professional website that clearly communicates their mission and services to a general audience seeking healthcare and social support. Technically, the website is built on WordPress with modern plugins and frameworks such as Yoast SEO, WPBakery, and Google Analytics integration. The site demonstrates good mobile optimization, SEO practices, and moderate performance. Security measures include HTTPS enforcement and standard security headers, although there is room for improvement in privacy compliance, particularly regarding cookie consent and terms of service visibility. The security posture is solid with no evident vulnerabilities or exposed sensitive data. However, the absence of WHOIS data limits the ability to fully verify domain legitimacy, which slightly impacts trust. Overall, the site is professional, trustworthy, and serves its community-focused mission effectively. Strategic recommendations include enhancing privacy compliance with explicit cookie consent, publishing terms of service and security policies, and improving accessibility features to meet broader compliance standards.

45
53
2
80
75
70
100
healthcarecommunityservicesnon-profitprimaryhealthmentalhealth+2 more
WordPressYoast SEOjQueryGoogle Tag Manager+5
2025-07-07T12:24:30.895Z
visitingmedia.com favicon

Visiting Media

visitingmedia.com

72
HospitalityN/amediumMEDIUM

Visiting Media is a specialized technology company providing immersive sales enablement software and virtual media production services tailored for the hospitality industry. Their platforms, including SalesHub and TrueTour, empower hospitality sales teams to leverage immersive content such as 3D models, virtual tours, and CGI to enhance sales presentations and marketing efforts. The company is positioned as a market leader in hospitality sales enablement, supported by industry recognitions and a strong customer base. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, Google Tag Manager, and multiple analytics and marketing tools. Hosting is via Amazon AWS infrastructure. The site demonstrates good performance, mobile optimization, and SEO practices, though accessibility could be improved. Security posture is solid with HTTPS enforced and domain locks in place, but DNSSEC is not enabled and some security headers are missing. From a security and compliance perspective, the site includes comprehensive privacy and cookie policies with active consent mechanisms, indicating GDPR compliance. No explicit security policies or incident response contacts were found. The domain WHOIS data is consistent with the business profile, showing a long-standing registration without privacy protection, enhancing trustworthiness. Overall, Visiting Media presents a professional, trustworthy, and technically competent online presence with strong business credibility in the hospitality technology sector.

55
68
17
98
67
85
100
hospitalitysalesenablementimmersivetechnologyvirtualtours3dmedia+2 more
WordPressYoast SEOjQueryGoogle Tag Manager+8
2025-07-07T11:22:07.650Z
rulegarza.com favicon

Rule Garza Howley LLP

rulegarza.com

56
GovernmentUnited StatessmallMEDIUM

Rule Garza Howley LLP is a specialized boutique law firm based in Washington, DC, focusing on antitrust legal services. The firm leverages over four decades of experience and a team of former senior antitrust officials to provide sophisticated advice and representation in high-profile matters involving government agencies such as the DOJ and FTC. Their client base primarily consists of multinational corporations requiring expert counsel on M&A, government investigations, and litigation. The firm positions itself as a nimble, responsive, and client-focused legal service provider with a strong market reputation. Technically, the website is built on WordPress and employs modern web technologies including jQuery, Google Analytics, Facebook SDK, and SEO plugins like Yoast. The site is mobile-optimized with good navigation and professional design, reflecting a mature digital presence. Performance is moderate, with room for improvement in accessibility and SEO enhancements. From a security perspective, the site uses HTTPS and integrates standard analytics and social media SDKs securely. However, it lacks explicit security headers and published security or incident response policies. Privacy compliance is minimal, with no visible privacy or cookie policies, which is a notable gap given the data collection via analytics and subscription forms. The WHOIS data is missing or inaccessible, which raises concerns about domain registration transparency despite the professional website content. Overall, the website presents a credible and professional front for the law firm but should address privacy compliance and domain registration transparency to enhance trust and security posture.

15
35
17
75
52
75
100
lawfirmantitrustlegalserviceswashingtondcprofessionalservices
jQueryGoogle AnalyticsFacebook SDKYoast SEO+4
2025-07-07T10:09:01.398Z
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

54
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
crossandsmith.com favicon

Cross & Smith LLC

crossandsmith.com

55
OtherUnited StatessmallMEDIUM

Cross & Smith LLC is a well-established personal injury law firm operating primarily in Alabama with offices in Tuscaloosa and Birmingham. The firm specializes in accident and injury cases, boasting over 25 years of experience and significant verdicts and settlements exceeding $150 million. Their business model is client-focused with a contingency fee structure, targeting individuals seeking legal representation for personal injury matters. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, supporting a strong market position in the regional legal services sector. Technically, the website is built on WordPress using a custom theme by PaperStreet, incorporating modern web technologies such as Yoast SEO for search optimization, Google reCAPTCHA for form security, and CallRail for call tracking. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some accessibility features are basic and there is room for improvement in performance and security headers. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms from spam. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers like HSTS and CSP, and the lack of a published security or incident response policy, indicate areas for enhancement. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism or GDPR-specific disclosures. Overall, the website is trustworthy and professional, with a solid business credibility score. Strategic improvements in privacy compliance, security header implementation, and incident response transparency would further strengthen the firm's digital security posture and regulatory adherence.

15
35
17
70
42
75
100
personalinjurylawfirmlegalservicesalabamaattorneys+2 more
WordPressYoast SEOFontAwesomeGoogle reCAPTCHA+2
2025-07-07T10:08:16.290Z
ffslawfirm.com favicon

Fridman Fels & Soto, PLLC

ffslawfirm.com

60
FinanceUnited StatessmallMEDIUM

Fridman Fels & Soto, PLLC is a boutique law firm specializing in white collar criminal defense, securities litigation, and complex investigations, primarily serving U.S. and Latin American clients. Founded in 2019 by former federal prosecutors, the firm emphasizes personalized client service and expertise in criminal and commercial law. Their market position is that of a specialized, trusted legal service provider with a strong reputation bolstered by client testimonials and industry citations. Technically, the website is built on WordPress with a modern tech stack including Bootstrap, WPBakery Page Builder, and Slider Revolution. Hosting appears to be via WP Engine, ensuring reliable performance. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Analytics and marketing tools such as Google Analytics and HubSpot are integrated, indicating moderate user tracking. From a security standpoint, the site uses HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled and no explicit security headers were detected, suggesting room for improvement. Privacy compliance is weak due to the absence of visible privacy and cookie policies. No incident response or vulnerability disclosure information is published. Overall, the website presents a professional and trustworthy image with good business credibility but could enhance its privacy and security posture to meet higher compliance standards.

15
50
17
60
75
80
100
lawfirmwhitecollardefenselitigationmiamilegalservices+2 more
WordPressPHPjQueryBootstrap+5
2025-07-07T10:07:46.145Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

56
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z