Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149091
Websites
130
Industries
113
Countries
52
Avg Score
Page 108 of 117|Showing 5351-5400 of 5850
forevergreen.es favicon

Forever Green

forevergreen.es

52
OtherSpainsmallMEDIUM

Forever Green is a Spanish sustainability program that leverages the power of football to promote environmental awareness and action. The website serves as a platform for companies to showcase their sustainability efforts and engage with a community focused on saving the planet. The business model centers on collaboration and visibility within the sports and environmental sectors, targeting companies interested in sustainability initiatives. The website is built on WordPress using the Divi theme and incorporates SEO best practices via the Yoast SEO plugin, indicating a moderate level of digital maturity. From a technical perspective, the site uses modern web technologies and includes a cookie consent mechanism compliant with GDPR standards. However, there is a lack of explicit privacy policies, terms of service, and contact information, which limits transparency and user trust. Security posture is basic, with no detected security headers or incident response contacts, and WHOIS data is inaccessible due to registry restrictions, reducing confidence in domain legitimacy verification. Overall, the website presents a professional and focused sustainability initiative but would benefit from enhanced security measures, clearer privacy and contact information, and improved transparency to strengthen trust and compliance. The current risk level is moderate, with recommendations to address privacy and security gaps to better protect users and the business reputation.

15
80
17
70
67
75
20
sustainabilityfootballenvironmentspanishwordpress+2 more
JavaScriptYouTube Player APIYoast SEO pluginGoogle Fonts
2025-06-23T13:39:10.556Z
culturalagents.org favicon

Cultural Agents, Inc., NGO

culturalagents.org

53
EducationUnited StatessmallMEDIUM

Cultural Agents, Inc. is a small, US-based non-profit organization founded in 2004 and affiliated with Harvard University. The organization focuses on integrating arts and humanities into civic engagement, targeting academics, artists, community leaders, and active citizens. Their offerings include academic courses, conferences, publications, internships, and a newsletter, positioning them as a niche educational and cultural platform. The website is professionally designed with consistent branding and good content quality, supporting their mission and audience engagement. Technically, the website is built on WordPress with modern plugins such as Elementor, Yoast SEO, and event management tools. It is hosted on Bluehost with HTTPS enabled and uses Google reCAPTCHA for form security. Performance and mobile optimization are moderate to good, with SEO practices in place. However, some accessibility features could be improved, and the contact form is currently misconfigured. From a security perspective, the site benefits from HTTPS and reCAPTCHA but lacks DNSSEC and important security headers, which are recommended for enhanced protection. The WHOIS data shows domain privacy protection, which is justified for a non-profit entity, and the domain age supports legitimacy. No critical vulnerabilities or exposed sensitive data were found, but improvements in security policies and incident response disclosures are advised. Overall, the website presents a trustworthy and credible platform with room for improvement in privacy compliance and security hardening. Strategic recommendations include publishing clear privacy and cookie policies, fixing contact form issues, enabling DNSSEC, and implementing security headers to strengthen the security posture and user trust.

30
53
17
85
67
75
20
artshumanitiescivicengagementeducationnon-profit+3 more
WordPress 6.8.1Yoast SEO pluginElementor 3.29.2jQuery 3.7.1+5

Partner Domains:

renaissancenow-cai.org
partner
pre-texts.org
partner

+1 more partners

2025-06-23T13:26:23.987Z
marketingautomagic.com favicon

iPresso

marketingautomagic.com

58
TechnologyN/amediumMEDIUM

The website marketingautomagic.com serves as a content marketing blog for iPresso, a marketing automation platform. It targets SME marketers and professionals interested in leveraging AI and automation to improve marketing outcomes. The site is positioned as a niche resource providing insights, tips, and news related to marketing automation, AI, and lead generation. The business model focuses on brand awareness and thought leadership to support the parent company iPresso. Technically, the site is built on WordPress with a modern tech stack including Yoast SEO, LayerSlider, and Slider Revolution plugins. It uses Google Analytics and Google Tag Manager for analytics and iPresso's own tracking scripts for marketing automation. The hosting provider is likely home.pl based on DNS records. The site is mobile optimized and SEO friendly with structured data and meta tags. From a security perspective, the site uses HTTPS with a valid SSL certificate and has domain transfer protection enabled. However, DNSSEC is not enabled and no advanced security headers were detected. There is no visible cookie consent mechanism despite tracking scripts, and no explicit security or incident response policies are published. Privacy policy exists but is basic and GDPR compliance indicators are minimal. Overall, the site is professionally maintained with good content quality and technical implementation. Security posture is adequate but could be improved with additional measures. Privacy compliance needs enhancement, especially regarding cookie consent. The domain registration data is consistent and trustworthy. Strategic recommendations include enabling DNSSEC, implementing security headers, adding cookie consent, and publishing security policies to enhance trust and compliance.

15
65
2
80
42
80
100
marketingautomationaiblogtechnology+1 more
WordPressYoast SEO pluginLayerSliderSlider Revolution+4

Partner Domains:

ipresso.com
partner
2025-06-23T13:26:03.948Z
icontracts.com favicon

RLDatix Life Sciences

icontracts.com

75
HealthcareN/amediumMEDIUM

RLDatix Life Sciences is a specialized provider of compliance and revenue management solutions tailored for the Life Sciences industry. The company has integrated the iContracts product suite under its brand to offer a comprehensive portfolio including contract management, policy management, revenue management, and professional services. Their market position is that of an established mid-sized player with a focus on delivering reliable, integrated solutions to pharmaceutical and biotech companies. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting industry professionals. Technically, the site is built on WordPress with modern SEO and analytics tools such as Yoast SEO, HubSpot, and Google Analytics, indicating a mature digital presence. Security posture is strong with HTTPS enforced and basic security headers present, though improvements in CSP and additional headers are recommended. Privacy compliance is well addressed with clear policies and consent mechanisms. However, the lack of WHOIS data limits domain trust verification, though the overall site professionalism and presence of compliance policies support legitimacy. Strategic recommendations include enhancing security headers, improving accessibility, and adding direct contact information for better business credibility.

80
83
17
75
82
80
100
lifesciencescompliancerevenuemanagementcontractmanagementpolicymanagement+3 more
WordPressYoast SEO pluginHubSpot scriptsGoogle Tag Manager+3

Partner Domains:

rldatix.com
parent
icontracts.com
subsidiary

+1 more partners

2025-06-23T13:24:43.780Z
J

Jeugdgezondheidszorg Kennemerland

jgzkennemerland.nl

55
HealthcareNetherlandsmediumMEDIUM

Jeugdgezondheidszorg Kennemerland is a regional Dutch healthcare provider specializing in youth health services and parental support, focusing on children aged 0-4 years and pregnant women. The organization offers a range of services including health consultations, vaccinations, workshops, and a dedicated digital app (JgzApp) to facilitate communication and health monitoring. The website reflects a well-established entity with a domain registered since 2004, indicating a mature presence in the healthcare sector within the Kennemerland region. Technically, the website is built on WordPress using modern plugins such as Yoast SEO and Contact Form 7, with integrations for Google Analytics and Tag Manager for tracking and marketing purposes. The site is mobile-optimized with good navigation and SEO practices, although accessibility features are basic. Performance is moderate, suitable for the target audience. From a security perspective, the site employs HTTPS with DNSSEC enabled, uses secure forms with validation, and does not expose sensitive data. However, it lacks explicit security headers and published incident response or vulnerability disclosure policies, which are recommended for enhanced security posture. Privacy compliance is strong, with clear GDPR-aligned privacy and cookie policies and consent mechanisms. Overall, the website presents a trustworthy and professional image with a high level of content relevance and business credibility. The absence of critical security issues and the presence of trust indicators such as privacy policies and BIG-registration references support a positive risk assessment. Strategic improvements in security policy transparency and technical security headers would further strengthen the organization's digital security stance.

15
28
2
50
95
65
100
healthcareyouthhealthparentalsupportvaccinationsworkshops+3 more
WordPressYoast SEO pluginContact Form 7CF7 Conditional Fields+6
2025-06-23T10:21:45.389Z
millistream.com favicon

Millistream AB

millistream.com

58
FinanceSwedenmediumMEDIUM

Millistream AB is a Sweden-based financial market data provider established in 2008, specializing in delivering real-time and historical market data, news, and corporate information from major global exchanges such as Nasdaq, NYSE, Deutsche Börse, and London Stock Exchange. The company targets financial institutions including banks, brokers, asset managers, and media companies, primarily in the Nordic region but with growing international reach. Their offerings include APIs, widgets, and a web-based trading application called Millistream Trader, designed to provide efficient and intuitive market views. Technically, the website is built on WordPress with the Enfold theme and leverages modern web technologies including jQuery, Google Analytics, and custom streaming APIs. The infrastructure supports low-latency data delivery via dedicated leased lines and cloud presence on AWS, indicating a mature and scalable technical setup. The site is mobile optimized and SEO friendly, though performance is moderate. From a security perspective, the site uses HTTPS and implements GDPR-compliant cookie consent mechanisms. However, it lacks publicly available privacy policies, terms of service, security policies, and incident response contacts, which are important for compliance and trust. No critical vulnerabilities or exposed sensitive data were detected, but security headers are not explicitly present, and no vulnerability disclosure policy is found. Overall, Millistream presents a professional and credible online presence with solid business and technical foundations. To enhance trust and compliance, it is recommended to publish comprehensive privacy and security policies, provide clear contact channels for security incidents, and implement additional security headers and disclosure mechanisms.

45
65
2
70
90
70
40
financialdatamarketdataapiwidgetstrader+2 more
WordPress 6.8.1Enfold Theme 4.5.7Yoast SEO pluginjQuery 3.7.1+4
2025-06-23T10:14:05.126Z
rccelta.es favicon

RC Celta

rccelta.es

66
MediaSpainmediumMEDIUM

RC Celta's official website serves as the primary digital platform for the professional football club, providing fans with news, ticket purchasing options, and club-related services. The site targets supporters and stakeholders interested in the club's activities and offerings. The business model centers on fan engagement and service provision through digital channels, positioning RC Celta as a recognized entity in the sports media sector within Spain. Technically, the website is built on WordPress CMS, leveraging popular plugins such as Yoast SEO and WPBakery Page Builder to enhance content management and SEO performance. Integration with Google Tag Manager, Google Analytics, and Cookiebot demonstrates a mature approach to analytics and privacy compliance. The site is mobile-optimized and exhibits good design and navigation clarity, supporting a positive user experience. From a security perspective, the website enforces HTTPS and includes several security headers, alongside the use of Google reCAPTCHA to mitigate bot activity. Cookie consent mechanisms comply with GDPR requirements, reflecting a commitment to privacy. However, the absence of explicit terms of service, security policy, and incident response contact information represents gaps in the security posture that could be addressed to enhance trust and compliance. Overall, the website is professional, trustworthy, and well-structured, with minor areas for improvement in security transparency and contact availability. The domain registration aligns with the club's identity, reinforcing legitimacy. Strategic recommendations include publishing comprehensive legal and security policies, enhancing accessibility, and establishing clear incident response channels.

50
83
17
55
65
80
100
sportsfootballclubofficialticketsales+4 more
WordPress 5.4Yoast SEO pluginWPBakery Page BuilderGoogle Tag Manager+2
2025-06-23T09:10:59.749Z
religioussistersofcharity.ie favicon

Religious Sisters of Charity

religioussistersofcharity.ie

10
OtherIrelandmediumCRITICAL

The Religious Sisters of Charity website represents a well-established non-profit religious organization engaged in education, healthcare, social and pastoral care, and human rights advocacy. Founded in 1815 in Dublin, Ireland, the organization maintains an international presence with communities in multiple countries. The website provides comprehensive information about their mission, history, vocations, and current activities, targeting supporters, potential vocations, and the general public interested in their charitable works. Technically, the website is built on WordPress using the Genesis Framework and several plugins including Yoast SEO and MonsterInsights for analytics. The site is moderately performant, mobile-optimized, and SEO-friendly, though accessibility features are basic. Security posture is good with HTTPS enforced and no exposed sensitive data, but lacks security headers and a cookie consent mechanism, which are areas for improvement. Overall, the security posture is solid but could be enhanced by implementing additional security headers and formalizing privacy and incident response policies. The domain registration details align well with the organization's identity, supporting legitimacy and trustworthiness. The site effectively supports the organization's mission and outreach but should address privacy compliance gaps to reduce regulatory risk.

-
-
-
-
-
-
-
non-profitreligiouscharityeducationhealthcare+2 more
WordPressYoast SEO pluginGoogle Analytics (MonsterInsights)jQuery+4
2025-06-23T03:14:01.455Z
rcophth.ac.uk favicon

The Royal College of Ophthalmologists

rcophth.ac.uk

40
HealthcareUnited KingdommediumHIGH

The Royal College of Ophthalmologists is a UK-based professional membership organisation and charity dedicated to promoting and supporting the ophthalmic profession nationally and internationally. The website serves as a comprehensive resource for members, trainees, researchers, and patients, offering information on training, examinations, research, policy, and events. The organisation holds a strong market position as the authoritative body for ophthalmology in the UK, with a clear focus on education, professional development, and advocacy. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Tag Manager, and cookie consent tools. It demonstrates good digital maturity with responsive design, accessibility considerations, and SEO optimization. Performance is moderate, with room for improvement in hosting and caching strategies. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible advanced security headers and a public security policy or incident response information. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong, with clear privacy and cookie policies and GDPR adherence. Overall, the website is professional, trustworthy, and well-maintained, with minor recommendations to enhance security headers and publish security policies. The domain registration data aligns well with the organisation's claims, supporting legitimacy and trustworthiness.

15
68
10
-
42
-
100
healthcareprofessionalmembershipeducationophthalmologyukcharity
jQuery 3.3.1Yoast SEO pluginGoogle Tag ManagerCookieControl by Civic UK+5
2025-06-22T15:06:09.429Z
scoreapp.com favicon

ScoreApp

scoreapp.com

66
TechnologyUnited KingdomsmallMEDIUM

ScoreApp is a UK-based technology company specializing in advanced quiz funnel marketing software designed to help businesses attract, engage, and convert leads through personalized quizzes, scorecards, and surveys. The platform offers a SaaS model with a strong emphasis on customization, integrations with popular CRM and marketing tools, and data-driven analytics to optimize marketing funnels. The website demonstrates a high level of professionalism with excellent content quality, clear navigation, and mobile optimization, targeting marketers and businesses seeking effective lead generation solutions. Technically, the website is built on WordPress with modern JavaScript frameworks like Alpine.js and integrates multiple analytics and tracking services including Google Tag Manager, Hotjar, Segment Analytics, and various social media pixels. The site is well-optimized for SEO and performance, with asynchronous loading of scripts and responsive design. Security posture is strong with HTTPS enforced and no visible vulnerabilities, though explicit security headers and policies could be improved. From a security and compliance perspective, the site includes comprehensive privacy and cookie policies that indicate GDPR compliance. However, it lacks visible security policies, incident response contacts, and vulnerability disclosure mechanisms. No direct company contact emails or phone numbers are found on the main page, which may impact direct communication channels. Overall, ScoreApp presents a trustworthy and mature digital presence with a solid technical foundation and good privacy practices. Strategic recommendations include enhancing security transparency, publishing incident response and vulnerability disclosure information, and providing clearer contact channels to further strengthen trust and compliance.

35
58
25
75
70
80
100
quizmarketingleadgenerationsaaspersonalization+3 more
WordPressYoast SEO pluginAlpine.jsGoogle Tag Manager+6
2025-06-22T14:19:25.246Z
corporatetools.com favicon

Corporate Tools LLC

corporatetools.com

66
TechnologyUnited StatesmediumMEDIUM

Corporate Tools LLC operates a professional website offering entity management software and corporate governance solutions primarily targeting law firms, accounting firms, registered agent services, and corporate secretaries. The company emphasizes real-time human support and provides software, logistics, and customer service solutions to facilitate business compliance and entity management. The website is well-structured, with clear navigation and consistent branding, reflecting a medium-sized technology company founded in 2019 in the United States. The technical infrastructure is based on WordPress with modern plugins such as Yoast SEO and Google Tag Manager, alongside analytics tools like Google Analytics and Ahrefs Analytics. The site is mobile optimized and performs moderately well, though accessibility features are basic. Security posture is solid with HTTPS enforced and no exposed sensitive data, but lacks security headers and formal security policies. Privacy compliance is partial, with privacy and terms policies present but no cookie consent mechanism. Overall, the security posture is good but could be improved by adding security headers, vulnerability disclosure policies, and cookie consent mechanisms. The domain registration details align well with the business claims, supporting legitimacy. The website demonstrates a high level of professionalism and trustworthiness, though some privacy and security best practices should be enhanced.

80
53
10
70
52
85
100
entitymanagementcorporategovernancesoftwarebusinesslogisticscustomerservice+3 more
WordPressYoast SEO pluginGoogle Tag ManagerFontAwesome+3
2025-06-22T11:52:58.283Z
data-display.com favicon

Data Display

data-display.com

34
TechnologyN/asmallHIGH

Data Display is a small technology-focused blog established in 2020, providing content primarily related to technology, SEO, internet marketing, web hosting, and blogging. The website leverages WordPress CMS with a professional theme and SEO plugin (Yoast SEO) to deliver well-structured and relevant content to its target audience of tech enthusiasts and marketing professionals. The site demonstrates good design quality, clear navigation, and mobile optimization, contributing to a positive user experience. Technically, the website uses a modern tech stack including WordPress 6.7.2, Bootstrap framework, jQuery, and Google Fonts. The site is served over HTTPS with no visible security vulnerabilities or exposed sensitive data. However, it lacks advanced security headers and explicit security policies. The absence of privacy and cookie policies, as well as direct contact information, indicates gaps in privacy compliance and user trust mechanisms. From a security perspective, the site shows a moderate posture with HTTPS enabled and no WAF or blocking mechanisms detected. There are no signs of malware or phishing, but the lack of incident response and vulnerability disclosure policies suggests room for improvement in security governance. The domain WHOIS data aligns well with the website's content and age, supporting legitimacy. Overall, Data Display is a credible and professionally maintained tech blog with good SEO and technical implementation but requires enhancements in privacy compliance, security policies, and contact transparency to improve trust and regulatory adherence.

15
10
-
85
-
70
20
techseointernetmarketingwebhostingblogging
WordPressYoast SEO pluginjQueryBootstrap+2
2025-06-22T09:00:06.923Z
bcu.ie favicon

Ballincollig Credit Union Ltd.

bcu.ie

49
FinanceIrelandsmallHIGH

Ballincollig Credit Union Ltd. is a well-established, locally focused financial cooperative serving the Ballincollig community in County Cork, Ireland. The organization operates on a not-for-profit basis, offering key financial services such as loans, savings accounts, mortgages, and insurance products. The website reflects a strong market position as a trusted credit union regulated by the Central Bank of Ireland, targeting local community members seeking favorable financial products and services. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, Google Analytics, and GDPR-compliant cookie consent mechanisms. The site demonstrates good digital maturity with responsive design, SEO optimization, and integration of online banking and loan calculator tools, enhancing user engagement and service accessibility. From a security perspective, the site enforces HTTPS, anonymizes IPs in analytics, and employs cookie consent with granular controls. No critical vulnerabilities or exposed sensitive data were detected. However, security headers could be improved, and incident response contact information is not explicitly provided. Privacy compliance is strong with comprehensive policies and GDPR adherence. Overall, the website presents a professional, trustworthy, and user-friendly digital presence for Ballincollig Credit Union. Strategic recommendations include enhancing security headers, publishing incident response contacts, and improving accessibility features to further strengthen security posture and compliance.

40
70
35
60
-
80
20
creditunionfinanceloanssavingsmortgages+3 more
WordPressYoast SEO pluginjQueryFont Awesome+3
2025-06-22T09:00:05.663Z
hnc.net favicon

Health Net Connections

hnc.net

38
HealthcareUnited KingdommediumHIGH

Health Net Connections (HNC) is a UK-based healthcare technology provider specializing in solutions for hospitals, doctors' surgeries, and private clinics across the UK and Europe. Their offerings include advanced image management and reporting systems (ViewPoint 6), centralized CTG data archives (Trium CTG), and hospital IT integration platforms (Talk2). The company is well-positioned in the healthcare technology market, trusted by over 90 NHS Trusts and more than 200 healthcare facilities. Their website reflects a professional and consistent brand image with clear business focus and strong trust indicators such as ISO certifications and Cyber Essentials. Technically, the website is built on WordPress with modern technologies including Yoast SEO and SiteGround Optimizer, delivering good performance and mobile optimization. The site uses HTTPS with excellent SSL configuration, though some security headers are not explicitly detected. Privacy compliance is partial, with a clear privacy policy but lacking cookie consent mechanisms and terms of service. Contact information is clearly presented, including phone numbers, emails, and physical address. Security posture is strong with ISO 27001 and Cyber Essentials certifications, no visible vulnerabilities, and no exposed sensitive data. However, the absence of incident response and vulnerability disclosure policies suggests room for improvement in security transparency and readiness. Overall, the website is trustworthy and professional, with minor gaps in privacy and security policy disclosures.

35
28
5
75
-
80
-
healthcaretechnologyiso27001iso9001cyberessentials+4 more
WordPressYoast SEO pluginSiteGround OptimizerSwiper.js+2
2025-06-22T09:00:04.767Z