Skip to main content

Transportation security reports

Browse 7,639 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 6 of 153|Showing 251-300 of 7639
F

FullForce Logistics Limited

fullforcelogistics.com

60
TransportationUnited KingdommediumMEDIUM

FullForce Logistics Limited is a UK-based logistics and haulage company operating from a 3-acre site in Coventry, Warwickshire. The company offers a range of services including haulage, pallet distribution, full and part load solutions, general haulage, line haul, and warehousing. It operates a modern fleet of vehicles ranging from 7.5t to 44t tractor units and serves businesses requiring efficient transportation and storage solutions. The company is part of a group with subsidiaries such as Matthew Kibble Transport and Shakespeare Transport, indicating a well-established regional presence. Technically, the website is built on WordPress using popular plugins like Slider Revolution and Contact Form 7, with Google reCAPTCHA v3 implemented for spam protection on contact forms. The site is mobile-optimized and has good SEO practices, though some accessibility features could be improved. Hosting details are not explicitly available, but the site uses HTTPS with a good SSL configuration. From a security perspective, the site enforces HTTPS and uses reCAPTCHA, but lacks several security headers and does not publish a security or incident response policy. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is partial, with a GDPR policy present but no cookie consent mechanism detected. Overall, the website presents a professional and trustworthy business front, but the absence of WHOIS data and domain registration details reduces trustworthiness. It is recommended to verify domain registration and enhance security and privacy disclosures to improve credibility and compliance.

69
70
70
100
-
35
2
logisticshaulagewarehousingpalletdistributiontransportation+1 more
WordPressPHPjQuerySlider Revolution plugin+2

Partner Domains:

fullforce.vigoportal.com
partner
www.palletforce.net
partner

+2 more partners

2026-07-13T07:19:59.042Z
middlehurst.co.uk favicon

Middlehurst Road Race & Classic

middlehurst.co.uk

49
TransportationUnited KingdomsmallHIGH

Middlehurst Road Race & Classic is a well-established family-owned automotive business based in St. Helens, Merseyside, with over 65 years of experience. The company specializes in the sale of specialist road, race, and classic vehicles, alongside a broad range of used cars. They also provide vehicle servicing, repairs, and MOT testing services. Their reputation is bolstered by their recognized expertise as Nissan specialists and their FCA authorization for credit brokerage. The website reflects a professional and consistent brand image, targeting car buyers interested in specialist and quality vehicles within the UK market. Technically, the website employs modern web technologies including jQuery, Owl Carousel, and Google Analytics, and is built on the Car Dealer 5 CMS platform. It offers good mobile optimization and SEO practices, with interactive features such as search forms and finance calculators. Security-wise, the site uses HTTPS and SSL, includes cookie consent mechanisms, and employs Google reCAPTCHA to protect forms. However, it lacks explicit security headers and a published security policy or incident response information. The WHOIS data for the domain is unavailable due to a domain naming rules error, which raises concerns about domain registration legitimacy, although the website content and business information appear legitimate and professional. Overall, the site scores well on content quality, technical implementation, and security posture, but the missing WHOIS data impacts trustworthiness and business credibility scores.

60
70
20
47
20
95
2
usedcarscardealercarsalesmottestingservicing+6 more
jQuerynoUiSliderSelect2Owl Carousel+5
2026-07-13T07:19:00.728Z
silverstarservice.com favicon

Silver Star Service Center, Inc.

silverstarservice.com

63
TransportationUnited StatessmallMEDIUM

Silver Star Service Center, Inc. is a family-owned automotive service business specializing in European and Tesla vehicles, operating in Annapolis, Maryland and the Chesapeake Bay area for over 30 years. The company offers a wide range of maintenance and repair services including factory scheduled services, cosmetic repairs, and convenience services, positioning itself as a trusted local expert with strong customer loyalty and industry certifications. Technically, the website is built on WordPress using the Divi theme and Slider Revolution plugin, with modern web technologies such as jQuery and FontAwesome. The site demonstrates good SEO practices and mobile optimization, though some accessibility features could be improved. Performance is moderate with room for enhancement. From a security perspective, the site uses HTTPS with good SSL configuration but lacks some important security headers and does not publish a security policy or incident response information. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism. Overall, the website presents a professional and trustworthy front for the business, though the absence of WHOIS data for the domain raises some legitimacy concerns that warrant further investigation. Strategic improvements in security headers, privacy compliance, and transparency would enhance trust and compliance posture.

80
69
40
75
17
70
70
automotiveeuropeancarsteslaserviceautorepaircarmaintenance+2 more
WordPressDivi ThemeSlider RevolutionjQuery+3

Partner Domains:

cbtrust.org
partner
tagofmd.com
partner

+3 more partners

2026-07-13T07:07:21.745Z
farrerandfenwick.co.uk favicon

Farrer and Fenwick

farrerandfenwick.co.uk

54
TransportationUnited KingdomsmallMEDIUM

Farrer and Fenwick is a well-established removals company based in Surrey, UK, operating since 2002. They offer a comprehensive range of services including domestic, business, and international removals, as well as secure storage solutions. Their market position is that of a trusted local and international service provider with strong customer support and recognized certifications such as BAR membership and Which Trusted Trader status. The website reflects a professional and consistent brand image with clear contact details and service descriptions. Technically, the website is built on WordPress using the Genesis Framework, leveraging common technologies such as jQuery and Contact Form 7 for forms. It integrates Microsoft Clarity for analytics and user behavior tracking. The site is mobile-optimized with good SEO practices and structured data enhancing search visibility. Performance is moderate, with room for improvement in accessibility and security headers. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks visible security headers and does not provide explicit incident response or vulnerability disclosure information. Privacy compliance is basic, with a privacy and cookie policy present but no active cookie consent mechanism. The overall security posture is good but could be enhanced by implementing recommended headers and formal security policies. Overall, the website is trustworthy, professional, and serves its business purpose effectively. Strategic improvements in security and privacy compliance would further strengthen its risk profile and customer trust.

42
100
65
55
15
68
2
removalsstorageinternationalsurreymoving+3 more
jQueryContact Form 7Google FontsMicrosoft Clarity

Partner Domains:

bar.co.uk
partner
trustedtraders.which.co.uk
partner
2026-07-13T07:02:43.024Z
B

B for BMW

b4bmw.co.uk

42
TransportationUnited KingdomsmallHIGH

B for BMW is an independent automotive service specialist focused on BMW vehicles, operating primarily in Glasgow, Clydebank, Edinburgh, and wider Scotland. The company offers a range of services including car repairs, MOT testing, servicing, air conditioning maintenance, and engine remapping. Positioned as an independent alternative to official BMW dealerships, the business targets BMW owners seeking specialized care. The website presents a professional image with clear contact details and integrated booking functionality, supporting customer engagement and service scheduling. Technically, the site employs modern web technologies such as Bootstrap 5, jQuery, and integrates third-party marketing and analytics tools including Google Analytics and Facebook Pixel. The site is mobile-optimized and exhibits good SEO practices, though accessibility features are basic. Security posture is adequate with HTTPS enforced and cookie consent implemented, but lacks advanced security headers and published security policies. The domain WHOIS data is unavailable due to a registration error indicating the domain name is invalid under Nominet UK rules, which raises concerns about domain legitimacy despite the professional website content. Overall, the site is functional and credible from a business perspective but would benefit from improved privacy and security transparency.

57
70
-
45
20
2
65
bmwautomotiveservicingrepairsmot+3 more
Bootstrap 5jQueryGoogle FontsFont Awesome 6+5
2026-07-12T07:17:22.587Z
yaa.org.uk favicon

Yorkshire Air Ambulance

yaa.org.uk

59
TransportationUnited KingdommediumMEDIUM

Yorkshire Air Ambulance is a well-established UK-based charitable organization providing rapid emergency air ambulance services to approximately 5 million people across Yorkshire. The website serves as a key platform for community engagement, fundraising, and information dissemination. It is professionally designed with clear navigation and strong branding consistency, targeting donors, volunteers, and the general public interested in emergency medical services. The business model relies heavily on donations and fundraising events, positioning Yorkshire Air Ambulance as a critical regional healthcare service provider. Technically, the website is built on WordPress with WooCommerce for e-commerce capabilities, integrated with modern analytics and marketing tools such as Google Analytics, Facebook Pixel, and Microsoft Clarity. Cookiebot is used for comprehensive cookie consent management, reflecting good privacy compliance practices. Security-wise, the site enforces HTTPS with strong security headers and no visible vulnerabilities, though it lacks a publicly available security policy or incident response information. The absence of WHOIS data is due to an invalid query on the www-prefixed domain, but the website content and external references strongly support its legitimacy. Overall, the site demonstrates a mature digital presence with room for improvement in transparency around security policies and incident response.

57
60
70
20
88
17
75
charityairambulancehealthcarenon-profitdonation+3 more
WordPressWooCommerceGoogle Tag ManagerCookiebot+4

Partner Domains:

muchloved.com
partner
tawk.to
service

+1 more partners

2026-07-12T07:12:57.320Z
centralmotorco.co.uk favicon

Central Motor Company (Bradford) Ltd

centralmotorco.co.uk

51
TransportationUnited KingdomsmallMEDIUM

Central Motor Company (Bradford) Ltd is a small, family-run used car dealership based in Bradford, West Yorkshire, with over 35 years of trading experience. The company offers a range of used vehicles, part exchange, warranty, finance options, and a national delivery service. Their website is professionally designed, mobile-optimized, and provides clear navigation and comprehensive business information, including contact details and regulatory compliance numbers. The business targets used car buyers primarily in the UK, focusing on customer service and competitive pricing. Technically, the website is built using a combination of static site generation (Hugo), jQuery, Foundation framework, and various JavaScript libraries for UI components and analytics. It integrates Google Analytics and Google Tag Manager for tracking and marketing purposes, and uses a finance API from Codeweavers. The site is served over HTTPS with good SSL configuration, though lacks some recommended security headers. Cookie consent and privacy policies are implemented with granular user controls, indicating good privacy compliance. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and cookie consent management. However, it lacks explicit security policies and incident response contacts, and no security headers were detected in the provided data. The WHOIS lookup for the 'www' subdomain failed due to domain naming rules, but the main domain is operational and consistent with the business information presented. No vulnerabilities or suspicious content were found. Overall, the website presents a trustworthy and professional online presence for a local used car dealership. Strategic recommendations include adding security headers, publishing a security policy, and maintaining regular audits of third-party scripts to enhance security posture and trustworthiness.

45
42
40
100
15
2
83
usedcarscardealershipbradfordwestyorkshireautomotive+3 more
Hugo 0.66.0jQueryFoundation frameworkSlick carousel+4
2026-07-12T07:09:04.616Z
platinummotoring.co.uk favicon

Platinum Motoring Solutions

platinummotoring.co.uk

44
TransportationUnited KingdomsmallHIGH

Platinum Motoring Solutions is a small, locally trusted auto repair garage based in Romford, United Kingdom, established in 2014. The company offers a comprehensive range of vehicle maintenance services including MOT testing, servicing, brakes, timing belt replacement, welding, exhaust, tyres, clutch repairs, and diagnostics. Their market position is that of a reliable and quality-focused local garage serving the community with affordable rates and manufacturer-compliant repairs. The website reflects a professional and consistent brand image with good content quality and clear navigation tailored to local vehicle owners. Technically, the site is built on WordPress using Elementor and Astra theme, with SEO optimization via Yoast and performance enhancements through WP Rocket. Mobile optimization is good, though accessibility features are basic. Security posture is moderate with HTTPS enabled and use of Google reCAPTCHA on forms, but lacks explicit security headers and published privacy or cookie policies, representing compliance gaps. The domain registration is consistent with the business age and claims, registered since 2014 with a reputable registrar, supporting legitimacy. Overall, the site is safe, professional, and trustworthy but would benefit from enhanced privacy compliance and security best practices.

85
20
60
57
35
15
2
autorepairmottestingcarservicinglocalgarageromford+1 more
WordPressElementorYoast SEOGoogle Fonts+1
2026-07-12T07:08:32.310Z
advanced-steam.org favicon

Advanced Steam Traction

advanced-steam.org

41
TransportationUnited KingdomsmallHIGH

Advanced Steam Traction is a specialized non-profit organization focused on the development and promotion of advanced steam locomotive technology, heritage steam operation, and engineering research. The organization operates through the Advanced Steam Traction Trust and its commercial arm, Advanced Steam Traction Services Ltd. Their market position is niche, serving engineers, heritage railway enthusiasts, and members interested in steam traction technology. The website provides extensive content including membership services, conferences, publications, and technical projects, targeting a specialized audience with a strong focus on engineering and heritage preservation. Technically, the website is built on WordPress with a mature tech stack including jQuery, Bootstrap, and bbPress for forums. The site is mobile-optimized and has good SEO practices, though performance is moderate. Hosting details are not explicit, but the domain is registered with GoDaddy and uses domaincontrol.com nameservers. Analytics tracking is minimal, with Jetpack Stats active and Google Analytics plugin installed but not configured. From a security perspective, the site uses HTTPS with a valid SSL certificate but lacks DNSSEC and explicit security headers such as CSP or HSTS. Forms use nonce tokens for security, and no sensitive data is exposed. However, the absence of privacy and cookie policies and vulnerability disclosure mechanisms indicates gaps in compliance and transparency. No WAF or blocking mechanisms are detected, and the domain registration is consistent and legitimate. Overall, the website is professional, content-rich, and trustworthy but would benefit from improved privacy compliance, enhanced security headers, and clearer analytics configuration to strengthen its security posture and user trust.

47
-
75
70
20
2
35
steamheritagelocomotiveengineeringmembership+3 more
WordPress 6.9.4PHPjQuery 3.7.1Bootstrap 2.3.2+5
2026-07-12T07:08:21.557Z
auragraphics.com favicon

Aura Brand Solutions Limited

auragraphics.com

52
TransportationUnited KingdommediumMEDIUM

Aura Brand Solutions Limited is a UK-based specialist in brand implementation and image management, serving sectors such as transportation, retail, and energy. The company offers comprehensive services including vehicle fleet branding, train refurbishment, signage, and architectural branding. It holds reputable certifications such as 3M Select Platinum Partner and is recognized with multiple industry awards, positioning it as a trusted and established player in its market. The website reflects a professional and consistent brand image with rich content and clear navigation, targeting businesses requiring expert brand management solutions. Technically, the website employs a modern technology stack including jQuery, Bootstrap, Slick Carousel, Flickity, and HubSpot forms, indicating a mature digital infrastructure. SEO and accessibility practices are well implemented, and the site is mobile optimized. Security posture is good with HTTPS enforced and cookie consent mechanisms in place, though some security headers and explicit security policies are absent. The WHOIS data for the domain is unavailable, which raises concerns about domain registration legitimacy. Despite this, the website's professional presentation, certifications, and active social media presence support its credibility. No critical vulnerabilities or exposed sensitive data were detected. Overall, the site demonstrates a solid security and compliance posture with room for improvement in transparency and domain registration clarity. Strategically, Aura should verify and publish domain registration details, enhance security headers, and provide explicit incident response contacts to strengthen trust and compliance. These steps will improve their security posture and reassure clients and partners of their commitment to best practices.

57
70
20
80
25
83
2
brandingvehiclewrappingsignagebrandimplementationcommercialvehicle+3 more
jQueryBootstrap 3.3Slick CarouselFlickity+4

Partner Domains:

glimma.com
partner
2026-07-12T07:05:18.971Z
groundhandling.com favicon

MA Business Ltd (a part of the Mark Allen Group)

groundhandling.com

49
TransportationUnited KingdommediumHIGH

Ground Handling International is a well-established publication and event organizer serving the global ground handling and aviation industry since 1995. It provides industry news, in-depth features, and organizes multiple international conferences, positioning itself as a key voice and community hub for ground handling professionals worldwide. The business operates under MA Business Ltd, part of the Mark Allen Group, based in the UK. Technically, the website uses a standard Bootstrap and jQuery stack with Font Awesome icons, delivering a responsive and professionally designed user experience. However, there is no evidence of advanced CMS or analytics integration in the provided HTML, and performance is moderate. Accessibility and SEO are basic but adequate for the site’s purpose. From a security perspective, the site lacks visible security headers and cookie consent mechanisms, and WHOIS data for the domain is missing, which raises some trust concerns. No forms or user input fields reduce attack surface, but the absence of HTTPS verification and security policies in the content limits the security posture. Privacy compliance is partially met with a clear privacy policy but no cookie consent banner. Overall, the website is professional and trustworthy in content and business representation but would benefit from improved security practices and transparency in domain registration data to enhance trust and compliance.

47
85
20
80
53
17
15
groundhandlingaviationconferencemagazinetransportation+1 more
BootstrapFont AwesomejQuery
2026-07-11T07:28:08.589Z
interken.com favicon

Interken Freighters

interken.com

51
TransportationUnited KingdomsmallMEDIUM

Interken Freighters is a small freight forwarding business operating in the Heathrow area of the United Kingdom. The company focuses on providing logistics and freight forwarding services to businesses, positioning itself as a niche player in the transportation sector. The website content is minimal but clearly oriented towards business clients requiring freight services near Heathrow. The domain has been registered since 2006, consistent with the company's claimed history. Technically, the website is built on WordPress using the Divi theme, with standard web fonts and a custom jQuery implementation. Hosting is provided by Cloud DNS Ltd. The site shows basic mobile optimization and moderate performance but lacks advanced SEO and accessibility features. No analytics or tracking services are detected, indicating minimal user tracking. From a security perspective, the website uses HTTPS but lacks DNSSEC and important security headers such as Content Security Policy or HSTS. There are no visible privacy, cookie, or terms of service policies, nor any incident response or vulnerability disclosure information. These gaps reduce the overall security posture and privacy compliance of the site. Overall, the website is functional and moderately credible for a small business but requires improvements in security best practices, privacy compliance, and content richness to enhance trust and professionalism.

47
100
70
80
35
2
15
freightforwardinglogisticstransportationheathrowuk
WordPressDivi ThemeGoogle FontsjQuery (custom implementation)
2026-07-11T07:28:03.058Z
heritagevolkswagen.co.uk favicon

Heritage Volkswagen

heritagevolkswagen.co.uk

62
TransportationUnited KingdommediumMEDIUM

Heritage Volkswagen is a reputable automotive dealership group specializing in Volkswagen vehicles, operating primarily in the South West of the United Kingdom with locations in Dorchester, Salisbury, and Yeovil. The company offers a comprehensive range of new and approved used Volkswagen cars, including electric and hybrid models, alongside financing options, servicing, and body repair services. As part of the larger Heritage Automotive group, it benefits from a strong market position and brand recognition, supported by FCA-regulated credit brokerage services and a commitment to customer satisfaction. Technically, the website demonstrates a mature digital infrastructure leveraging modern web technologies such as jQuery, Bootstrap, Google Analytics, Facebook Pixel, and Cookiebot for privacy compliance. The site is built on Umbraco CMS, features responsive design, and includes accessibility and SEO best practices. Security measures include HTTPS enforcement, use of Google reCAPTCHA on forms, and cookie consent management, although some security headers could be enhanced. The security posture is solid with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and GDPR adherence. However, WHOIS data could not be retrieved due to a query error on the subdomain, which slightly impacts domain trust verification but does not detract from the overall legitimacy indicated by the website content and business disclosures. Overall, Heritage Volkswagen presents a professional, trustworthy, and customer-focused online presence with strong business credibility and technical implementation. Strategic improvements in security headers and incident response transparency would further enhance their security posture.

69
75
-
100
17
65
88
automotivevolkswagencardealershipusedcarsnewcars+4 more
jQueryBootstrap 4.3.1Google AnalyticsFacebook Pixel+4

Partner Domains:

www.heritage-audi.co.uk
sister
www.heritagehonda.co.uk
sister

+3 more partners

2026-07-11T07:27:29.563Z
magnamazda.co.uk favicon

Magna Mazda

magnamazda.co.uk

68
TransportationUnited KingdommediumMEDIUM

Magna Mazda is a well-established authorised Mazda car dealership group operating in Dorset, Hampshire, and Wiltshire, UK, with over 40 years of experience. The company offers a comprehensive range of new and used Mazda vehicles, servicing, MOTs, and vehicle valuation services. Their website reflects a professional and consistent brand image, targeting car buyers and vehicle owners in their regional market. The business model focuses on automotive retail and aftersales services, positioning Magna Mazda as a trusted regional player in the transportation sector. Technically, the website employs a modern technology stack including jQuery, Bootstrap, Google Analytics, Facebook Pixel, and Cookiebot for privacy compliance. The site is built on ASP.NET WebForms and uses COG CMS as its content management system. The website is mobile-optimized with good SEO and accessibility features, providing a positive user experience. Analytics and marketing tools are extensively used for user tracking and advertising. From a security perspective, the site enforces HTTPS and uses cookie consent mechanisms, but lacks explicit security headers such as Content-Security-Policy and X-Frame-Options. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data for the domain reduces trust from a domain registration standpoint, but the website content and external trust signals support legitimacy. Overall, Magna Mazda's website demonstrates a solid digital presence with good content quality, technical implementation, and privacy compliance. The main risk area is the incomplete WHOIS data, which should be investigated further. Strategic recommendations include enhancing security headers, verifying domain registration details, and publishing explicit security and incident response policies to strengthen trust and compliance.

100
75
65
69
65
88
2
automotivecardealershipmazdausedcarsnewcars+2 more
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+4

Partner Domains:

shop.mazda.co.uk
partner
www.judgeservice.com
partner
2026-07-11T07:26:20.574Z
gama.aero favicon

General Aviation Manufacturers Association

gama.aero

53
TransportationUnited StatesmediumMEDIUM

The General Aviation Manufacturers Association (GAMA) operates a professional and well-structured website serving as an industry association for the global general aviation manufacturing sector. The site provides advocacy, data, publications, career resources, and event information targeting industry stakeholders, members, media, and students. The website demonstrates a mature digital presence with multilingual support and modern web technologies including WordPress CMS, Google Analytics, and Google Maps integration. SEO and content quality are good, with clear navigation and consistent branding. From a security perspective, the site uses HTTPS and includes some security best practices such as nonce usage in logout URLs. However, it lacks explicit security headers and visible incident response or security policy pages. Privacy compliance is partial, with a cookie consent mechanism present but no explicit privacy policy or terms of service detected in the provided content. WHOIS data confirms the domain's legitimacy, showing consistent registration details aligned with the business entity and a long domain age appropriate for an established association. Overall, the website is trustworthy and professional with moderate security posture and some room for improvement in privacy and security transparency. There are no indications of malicious or suspicious content, and the site is safe for general audiences.

47
75
65
40
17
85
15
aviationgeneralaviationmanufacturingindustryassociationaviationjobs+2 more
jQueryGoogle AnalyticsGoogle Tag ManagerYoast SEO+5
2026-07-11T07:24:29.539Z
citysprint.co.uk favicon

CitySprint

citysprint.co.uk

68
TransportationUnited KingdomlargeMEDIUM

CitySprint is a well-established UK courier and parcel delivery service offering a range of express delivery options including same day, next day, and international services. The company targets both business and individual customers across the UK, providing online booking and account management capabilities. The website reflects a professional and consistent brand presence with good content quality and clear navigation. Technically, the site leverages modern web technologies such as React and integrates marketing and analytics tools including Google Tag Manager and TradeDoubler. Cookie consent and privacy policies are implemented, indicating attention to privacy compliance. Performance and mobile optimization are adequate, though accessibility features could be improved. From a security perspective, the site enforces HTTPS and includes standard security headers. However, there is no publicly available security policy or incident response contact, and no vulnerability disclosure mechanism is present. The WHOIS data is unavailable due to a domain naming rules error, which slightly reduces trustworthiness but does not directly impact the operational security posture. Overall, CitySprint's website is professional and trustworthy with moderate to good security and privacy practices. Strategic improvements in transparency around security policies and enhanced accessibility would further strengthen their digital maturity and trust profile.

70
100
72
100
2
85
40
courierdeliverylogisticsparceldeliverysamedaydelivery+3 more
ReactGoogle Tag ManagerOneTrust Cookie ConsentSalesforce Embedded Messaging+1
2026-07-11T07:17:47.614Z
startintractors.co.uk favicon

Startin Tractors Limited

startintractors.co.uk

58
TransportationUnited KingdommediumMEDIUM

Startin Tractors Limited operates as a UK-based supplier and retailer specializing in new and used agricultural machinery including tractors, combines, telehandlers, forklifts, excavators, and pickups. The company maintains a strong market position with multiple brand partnerships and offers additional services such as finance brokering and precision farming support. Their website reflects a professional and consistent brand image targeting agricultural professionals and machinery buyers. Technically, the website employs a modern JavaScript-based tech stack including jQuery, Google Maps API, Google Analytics, and various UI libraries such as Slick Carousel and PhotoSwipe. The site is mobile optimized with good navigation and content quality, although some accessibility features could be improved. Performance is moderate with asynchronous loading of analytics scripts. From a security perspective, HTTPS is used, but explicit security headers and cookie consent mechanisms are not evident in the provided data. The WHOIS data for the domain is missing or invalid, indicating possible domain registration issues, which slightly impacts trustworthiness. No vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, the website presents a credible and professional business front with room for improvement in security best practices and privacy compliance. The domain registration inconsistency should be investigated further to ensure legitimacy and reduce risk.

65
70
47
100
68
20
17
agriculturetractorsmachineryequipmenttransportation+3 more
jQueryGoogle Maps APIGoogle Analytics (gtag.js)PhotoSwipe+5

Partner Domains:

www.cnhcapital.com
partner
www.caseih.com
partner

+3 more partners

2026-07-11T07:13:07.941Z
londontravelwatch.org.uk favicon

London TravelWatch

londontravelwatch.org.uk

62
TransportationUnited KingdommediumMEDIUM

London TravelWatch operates as the statutory transport watchdog for London, advocating on behalf of the public to improve transport services across the capital. The organization maintains a strong market position as an independent watchdog, partnering with Transport Focus to enhance its reach and effectiveness. Their key services include transport advocacy, handling complaints, conducting research, and providing public advice. The website reflects a professional and trustworthy image with consistent branding and comprehensive content tailored to London transport users and stakeholders. Technically, the website is built on WordPress with a modern tech stack including jQuery, Yoast SEO, Algolia Search, and Plausible Analytics. It demonstrates good performance, mobile optimization, accessibility, and SEO practices. The site uses HTTPS and includes cookie consent mechanisms aligned with GDPR requirements, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and employs cookie consent with denied personalization and tracking by default. While explicit security headers are not fully confirmed, no vulnerabilities or exposed sensitive data were detected. The absence of a security.txt or vulnerability disclosure page is noted as an area for improvement. Overall, the security posture is solid but could be enhanced with additional headers and formal vulnerability disclosure. The WHOIS data is unavailable due to domain naming rules errors, limiting direct verification of domain registration details. Despite this, the website content, certifications, and partner references strongly indicate legitimacy. The overall risk is low, but the lack of WHOIS transparency slightly reduces trustworthiness. Strategic recommendations include improving security headers, publishing a security.txt file, and ensuring WHOIS data availability or transparency to enhance domain trust.

27
100
85
70
100
2
30
transportadvocacylondonpublicservicenon-profit+2 more
WordPressjQueryYoast SEOAlgolia Search+3

Partner Domains:

transportfocus.org.uk
partner
2026-07-10T07:24:46.519Z
essex-commercial.co.uk favicon

Essex Commercial

essex-commercial.co.uk

49
TransportationUnited KingdomsmallHIGH

Essex Commercial is a UK-based small business specializing in commercial vehicle body repairs and resprays, serving clients primarily in Essex and surrounding areas. The company offers services for lorries, trucks, vans, and horse boxes, positioning itself as a local specialist with a focus on quality and customer satisfaction. The website reflects a professional and consistent brand image with clear contact details and client trust indicators such as logos from recognized brands. Technically, the website employs a modern JavaScript stack including jQuery, Modernizr, Google reCAPTCHA, and Google Tag Manager for analytics and spam protection. The site is mobile-optimized with good SEO practices but lacks visible advanced security headers and explicit cookie consent mechanisms. Performance is moderate, and accessibility is basic. From a security perspective, the site uses HTTPS and Google reCAPTCHA but does not show evidence of comprehensive security headers or incident response policies. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy. However, the website content and contact information suggest a legitimate business operation. Overall, the website scores moderately well in content quality, technical implementation, and business credibility but has room for improvement in security posture and privacy compliance. Strategic recommendations include enhancing security headers, implementing cookie consent, verifying domain registration, and publishing clear security and privacy policies.

20
60
57
85
68
30
2
commercialvehiclerepairbodyworkresprayessexvehiclerepair+1 more
jQuery 3.6.0Modernizr 3.11.2Google reCAPTCHAGoogle Tag Manager+4
2026-07-10T07:20:31.666Z
hippowaste.co.uk favicon

Waste Management Systems Ltd.

hippowaste.co.uk

67
TransportationUnited KingdommediumMEDIUM

HIPPO, operated by Waste Management Systems Ltd., is a well-established UK-based rubbish removal service provider with over 20 years of experience. The company offers a variety of waste disposal solutions including HIPPOBAG, Man and Van, Skip Hire, and trade waste services, targeting both residential and business customers across the UK. Their market position is strong, supported by certifications such as ISO14001 and ISO9001, and a high customer satisfaction rating on Trustpilot. The website reflects a professional and trustworthy brand with consistent branding and comprehensive service information. From a technical perspective, the website employs modern web technologies including jQuery, Google Tag Manager, Trustpilot widgets, and OneTrust for cookie consent management. The site is mobile-optimized with good SEO practices and moderate performance. Security posture is generally good with HTTPS enforced and cookie consent mechanisms in place, though some security headers are not explicitly detected and no public security policy or incident response contacts are found. The WHOIS data for the domain is incomplete and indicates an error related to domain naming rules, likely due to querying the 'www' subdomain instead of the root domain. Despite this, the website content and business information appear legitimate and professional. No adult or NSFW content is present, and privacy compliance is well addressed with clear policies and consent banners. Overall, HIPPO presents a credible and professional online presence with strong business credibility and good technical implementation. Security can be improved by adding explicit security headers and publishing incident response information. The WHOIS discrepancy should be clarified by querying the correct domain name.

77
65
100
75
2
73
65
rubbishremovalwastemanagementskiphirehippobagmanandvan+3 more
jQueryGoogle Tag ManagerTrustpilot WidgetOneTrust Cookie Consent+2
2026-07-10T07:18:06.232Z
C

Car Concierge

carconciergeservice.co.uk

46
TransportationUnited KingdomsmallHIGH

Car Concierge, operating under the brand Abels Car Concierge Service, is a UK-based company specializing in premium vehicle storage, transportation, and shipping services. Established since at least 2010, the company holds a prestigious Royal Warrant, underscoring its reputation for quality and reliability. The website clearly targets vehicle owners seeking secure and professional car storage and transport solutions across the UK, Europe, and worldwide. The business model focuses on service provision with a strong emphasis on trust and heritage. Technically, the website is built on WordPress with a moderate technology stack including popular plugins for analytics, forms, and UI enhancements. The site is moderately optimized for performance and mobile use, with good SEO practices evident in metadata and structured data. However, accessibility and advanced mobile optimization are basic. Security posture is adequate with HTTPS enforced and no exposed sensitive data, but lacks advanced HTTP security headers and visible security policies. From a security and compliance perspective, the site does not display explicit privacy or cookie consent mechanisms, which may pose GDPR compliance risks. There is no published incident response or vulnerability disclosure information. The domain registration data aligns well with the business claims, supporting legitimacy. Overall, the site is professional and trustworthy but could improve in privacy compliance and security transparency. Strategically, the company should prioritize implementing cookie consent and privacy enhancements, publish clear security policies, and adopt security headers to strengthen its security posture and regulatory compliance. These improvements will enhance customer trust and reduce risk exposure.

47
85
60
20
15
58
2
carstorageluxurycartransportclassiccartransportationcarshippingvehicleremovals+2 more
WordPressPHPjQueryGoogle Analytics+6

Partner Domains:

abels.co.uk
partner
blueskycreativeuk.com
partner
2026-07-10T07:16:19.909Z
silvershieldwindscreens.co.uk favicon

Silver Shield Windscreens

silvershieldwindscreens.co.uk

50
TransportationUnited KingdomsmallMEDIUM

Silver Shield Windscreens is a UK-based company specializing in automotive glass repair and replacement services, including windscreen repairs, replacements, fleet services, specialist glazing, and ADAS recalibration. The company targets fleet owners, business owners, and private vehicle owners across England and Wales, emphasizing quality service at competitive prices with trained technicians and insurance claim support. The website presents a professional image with clear contact details and service descriptions. Technically, the website employs legacy technologies such as jQuery 1.8.3 and Modernizr 2.6.2, alongside Google Analytics and Tag Manager for tracking. The site is mobile-optimized with a cookie consent mechanism, but lacks visible modern security headers and uses an outdated JavaScript library, which may pose security risks. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS (assumed from external scripts loaded via HTTPS), but no explicit security headers were detected in the provided data. The cookie consent banner and privacy policies indicate GDPR compliance efforts, though no incident response or vulnerability disclosure information is present. The WHOIS lookup failed due to domain naming rules violation, raising concerns about domain registration legitimacy, though the website content is consistent with a legitimate business. Overall, the website is functional and professional but would benefit from technical and security improvements, including updating libraries, implementing security headers, and clarifying domain registration status to enhance trust and compliance.

47
60
85
20
15
95
2
windscreenrepairwindscreenreplacementfleetservicesadasrecalibrationspecialistglazing+3 more
jQuery 1.8.3Google AnalyticsGoogle Tag ManagerModernizr 2.6.2+1
2026-07-10T07:09:34.977Z
directvehicleglass.co.uk favicon

Direct Vehicle Glass

directvehicleglass.co.uk

46
TransportationUnited KingdommediumHIGH

Direct Vehicle Glass is a well-established UK-based company specializing in mobile windscreen repair and replacement services, primarily serving Liverpool, Warrington, Manchester, and the wider North West region. The company positions itself as a leading independent automotive glazing provider with a focus on quality and responsiveness. Their key services include private and commercial vehicle glass repair, fleet cover, and advanced driver assistance system (ADAS) calibration. The website reflects a medium-sized business with a professional online presence and multiple insurance partnerships that enhance trustworthiness. Technically, the website is built on WordPress and utilizes modern web technologies such as jQuery, Slick Carousel, and Google Analytics for tracking. The site is mobile-optimized with good SEO practices implemented via Yoast SEO. Performance is moderate, and accessibility is basic but functional. The site uses HTTPS with an excellent SSL configuration, though it lacks some security headers that could improve its security posture. From a security perspective, the site demonstrates good baseline practices such as HTTPS and no visible sensitive data exposure. However, it lacks published security policies, incident response information, and a cookie consent mechanism, which are important for GDPR compliance and user trust. No vulnerabilities or suspicious content were detected. The domain registration data aligns well with the business claims, indicating legitimacy and a strong trust foundation. Overall, the website is professional, credible, and secure enough for its business purpose but would benefit from enhanced privacy compliance and security transparency to improve user trust and regulatory adherence.

70
65
20
47
53
17
15
windscreenrepairvehicleglassmobileserviceadascalibrationfleetcover+4 more
jQuerySlick CarouselGoogle AnalyticsYoast SEO
2026-07-10T07:07:53.481Z
traffixuk.com favicon

Traffix Ltd

traffixuk.com

61
TransportationUnited KingdommediumMEDIUM

Traffix Ltd is a well-established UK-based company specializing in temporary traffic and event management services. Operating since 2005 with a domain registered in 2006, the company maintains a strong market position in the transportation sector, serving complex infrastructure projects, construction, highway maintenance, utilities, and high-profile events. Their service portfolio is comprehensive, supported by multiple strategically located depots and a 24/7 emergency callout service. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting businesses and organizations requiring traffic management solutions in Central England and beyond. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WPBakery Page Builder, and Slider Revolution. It employs Google Analytics and Facebook Pixel for analytics and marketing, and implements cookie consent mechanisms aligned with GDPR requirements. Hosting is provided by s2hosting.co.uk, and the site shows good mobile optimization and moderate performance. Security posture is solid with HTTPS enabled and reCAPTCHA on forms, though improvements could be made by enabling DNSSEC and adding security headers. No WAF or blocking mechanisms were detected, allowing full content access. The WHOIS data is consistent with the business claims, showing a long domain age and transparent registration without privacy protection, supporting legitimacy. Contact information is clearly presented with multiple phone numbers, emails, and physical addresses. Social media presence is active across major platforms, enhancing trust and outreach. Overall, Traffix Ltd demonstrates a mature digital presence with good security and privacy compliance, making it a trustworthy and professional service provider in its industry.

60
100
85
27
45
85
2
trafficmanagementeventmanagementtransportationukbusinesswordpress+3 more
WordPressPHPYoast SEO pluginWPBakery Page Builder+7
2026-07-10T07:07:42.790Z
gtwholesale.co.uk favicon

Group Tyre Wholesale Limited

gtwholesale.co.uk

55
TransportationUnited KingdommediumMEDIUM

Group Tyre Wholesale Limited is a UK-based tyre wholesaler established in 2010, specializing in supplying a wide range of tyres for cars, vans, and 4x4 vehicles. The company targets automotive trade professionals and garages, offering trade online ordering, account management, and employee training resources. Their market position is supported by over 14 years of operation, a large stock inventory, and a dedicated delivery fleet. Technically, the website is built on WordPress using the Divi theme, leveraging common web technologies such as jQuery and PHP. The site demonstrates moderate performance and good mobile optimization but could improve accessibility and SEO. Security posture is solid with HTTPS and DNSSEC enabled, though additional HTTP security headers and published security policies would enhance trust. Privacy compliance is well addressed with clear cookie and privacy policies and a consent mechanism. Overall, the website is professional and trustworthy, with clear business information and contact channels, though no direct company emails were found. Strategic recommendations include enhancing security headers, publishing incident response information, and improving SEO and accessibility.

47
70
85
20
2
50
85
tyreswholesaleruktradeautomotive+1 more
WordPressDivi ThemejQueryPHP

Partner Domains:

gtw3.thevirtualwarehouse.co.uk
partner
grouptyrewholesale.astute-elearning.com
partner

+1 more partners

2026-07-09T07:22:32.585Z