Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 92 of 115|Showing 4551-4600 of 5746
gilston.digital favicon

Gilston Digital SA

gilston.digital

50
TechnologySwitzerlandsmallMEDIUM

Gilston Digital SA is a Swiss-based technology company specializing in the creation of web and mobile applications, offering consulting and development services. With nearly 25 years of experience in the digital domain, the company positions itself as a trusted partner for businesses seeking effective and affordable digital solutions. Their portfolio includes diverse projects ranging from e-commerce to bespoke web applications, supported by a strong emphasis on UX design and ongoing maintenance. Technically, the website is built on WordPress with modern frameworks like Bootstrap and integrates essential tools such as Google Maps and reCAPTCHA for enhanced user experience and security. The presence of a cookie consent mechanism demonstrates awareness of privacy regulations, although a formal privacy policy is not found on the site. Security posture is solid with HTTPS and reCAPTCHA usage, but could be improved by enabling DNSSEC and implementing security headers. Overall, the domain registration data aligns well with the company's Swiss identity and business claims, supporting legitimacy. Strategic recommendations include publishing a privacy policy, enhancing security headers, and establishing a vulnerability disclosure process to strengthen compliance and trust.

15
65
17
70
52
80
20
webdevelopmentmobileapplicationsdigitalsolutionsconsultingswisscompany+2 more
WordPressBootstrapjQuerySlick Carousel+4

Partner Domains:

gilston.consulting
partner
miru.digital
partner

+1 more partners

2025-07-08T06:25:29.526Z
invivomagazine.com favicon

Centre hospitalier universitaire vaudois (CHUV)

invivomagazine.com

53
HealthcareSwitzerlandmediumMEDIUM

The website invivomagazine.ch serves as the official magazine platform for the Centre hospitalier universitaire vaudois (CHUV) in Lausanne, Switzerland. It provides accessible health-related content to a broad audience, leveraging expert knowledge from the hospital. The site is well-positioned as a trusted source of medical news and advice, supported by a professional design and consistent branding. The business model focuses on informational publishing with subscription options for past issues, targeting the general public interested in health and wellness topics. Technically, the site is built on TYPO3 CMS, a robust and mature content management system, supplemented by modern JavaScript libraries such as jQuery, Slick Carousel, and LightGallery. The site demonstrates good mobile optimization and SEO practices, although accessibility features could be enhanced. Performance is moderate, with room for improvement in loading speed and technical modernization. From a security perspective, the site enforces HTTPS and uses Matomo analytics with cookies disabled to respect user privacy. However, it lacks explicit security policies, incident response information, and vulnerability disclosure mechanisms. Security headers are not visibly implemented, which could be improved to enhance protection. No vulnerabilities or exposed sensitive data were detected in the provided content. Overall, the website presents a low-risk profile with strong business credibility and privacy compliance. Strategic recommendations include implementing security headers, publishing security and incident response policies, and enhancing accessibility and performance to further strengthen the site's security posture and user experience.

70
50
17
60
72
75
-
healthmedicalmagazinechuvswitzerland+2 more
TYPO3 CMSjQuery 3.7.1Slick CarouselLightGallery+2

Partner Domains:

www.chuv.ch
partner
www.unil.ch
partner

+1 more partners

2025-07-08T06:25:19.483Z
uacg.bg favicon

Университет по Архитектура Строителство и Геодезия

uacg.bg

44
EducationBulgarialargeHIGH

The website represents the University of Architecture, Civil Engineering and Geodesy (UACG) in Bulgaria, a well-established public higher education institution specializing in architecture, construction, and geodesy. The site provides comprehensive academic information, news, events, and virtual campus access targeting prospective and current students, researchers, and academic staff. The university maintains a consistent brand presence and offers multiple academic programs and research activities, positioning itself as a key player in Bulgarian higher education in its sector. Technically, the website uses modern frameworks such as Bootstrap and jQuery, integrates Google Analytics and Tag Manager for tracking, and implements cookie consent mechanisms, reflecting a moderate to good digital maturity. Security posture is adequate with HTTPS and reCAPTCHA usage, though it lacks explicit security headers and incident response disclosures. The domain WHOIS data is privacy protected in compliance with GDPR, which is typical for EU entities, and the domain status is active and consistent with the institution's legitimacy. Overall, the site is professional, secure, and compliant with privacy regulations, serving its educational mission effectively.

15
25
17
70
82
60
-
educationuniversityarchitectureconstructiongeodesy+3 more
Bootstrap 5.3.2jQuery 3.6.0Slick CarouselGoogle Tag Manager+4

Partner Domains:

my.uacg.bg
service
old.uacg.bg
service

+2 more partners

2025-07-08T06:22:01.035Z
matesz.hu favicon

Magyar Terjesztés-ellenőrző Szövetség

matesz.hu

10
MediaHungarysmallCRITICAL

The Magyar Terjesztés-ellenőrző Szövetség (MATESZ) is a well-established Hungarian self-regulatory professional association specializing in auditing and certifying print and digital circulation data for the Hungarian press market. Founded in 1993 with a domain registered since 1999, it holds a credible market position as the authoritative source for circulation data transparency. The website provides information about their auditing services, publishes data reports, and offers an online analysis tool for members. Contact information including a physical address and phone number is clearly provided, and the site uses Google reCAPTCHA to secure its contact form. Technically, the website employs a modern frontend stack including jQuery, Bootstrap, DataTables, and Slick Carousel. It uses HTTPS with no detected security challenges or blocking mechanisms. Google Analytics is implemented conditionally based on user cookie consent, and a GDPR-compliant cookie consent banner is present with revocation capability. The site is mobile optimized with good navigation and professional design, though no CMS or hosting provider details are evident. From a security perspective, the site demonstrates good practices such as HTTPS enforcement, spam protection on forms, and cookie consent management. However, it lacks explicit security policies, incident response contacts, and vulnerability disclosure information. No security headers were detected in the HTML content, suggesting room for improvement in hardening. No vulnerabilities or exposed sensitive data were found. Overall, the website is trustworthy, professionally maintained, and compliant with basic privacy regulations. The absence of privacy and terms of service pages and security policy documentation are notable gaps. Strategic recommendations include publishing these policies, adding security headers, and providing incident response contacts to enhance trust and compliance.

-
-
-
-
-
-
-
mediaauditcirculationhungarypublishing+1 more
jQueryBootstrapDataTablesSlick Carousel+2
2025-07-07T23:56:11.618Z
indexcoop.com favicon

Index Cooperative

indexcoop.com

66
FinanceN/amediumMEDIUM

Index Cooperative is a decentralized autonomous organization (DAO) focused on providing innovative DeFi products such as leveraged tokens and yield optimization strategies. The company positions itself as a market leader in on-chain structured products, offering automated and user-friendly tools for crypto investors and traders. Their product suite includes leverage tokens with built-in liquidation protection and smart looping strategies to amplify returns. The website demonstrates a high level of professionalism, with comprehensive content, strong branding, and clear navigation. Technically, the site is built using modern frameworks including Astro and React, with performance and mobile optimization rated as excellent. The use of advanced frontend technologies and integration with DeFi platforms like Ethereum and Arbitrum reflects a mature digital infrastructure. Analytics and error monitoring are implemented via Sentry, and cookie consent mechanisms are in place to ensure privacy compliance. From a security perspective, the project has undergone multiple independent smart contract audits and maintains an active bug bounty program through Immunefi, indicating a strong commitment to security best practices. The website enforces HTTPS and likely employs standard security headers, although explicit header details are not visible. No vulnerabilities or exposed sensitive data were detected in the analysis. Overall, the website and project present a low-risk profile with strong trust indicators, though the absence of WHOIS registrant data and explicit incident response contacts slightly reduce the business credibility score. Strategic recommendations include publishing clearer incident response contacts, security.txt files, and enhancing transparency around data protection roles to further strengthen trust and compliance.

30
53
35
85
72
65
100
defifinancecryptocurrencyleveragetokensyieldfarming+2 more
AstroReactTailwind CSSSlick Carousel+1
2025-07-07T23:52:10.558Z
A

Australia’s Women’s Bowls: Graded Teams, State Results, Archives

womensbowlsnsw.org

54
OtherAustraliasmallMEDIUM

The website 'Australia’s Women’s Bowls: Graded Teams, State Results, Archives' serves as a specialized informational resource documenting the history, structure, and competitive records of women's lawn bowls in Australia. It targets enthusiasts, players, and community members interested in the sport's evolution and current competitive landscape. The business model is primarily archival and informational, without commercial or promotional intent, positioning it as a niche sports heritage site. Technically, the site is built on WordPress 6.8.1, leveraging a variety of modern JavaScript libraries and CSS frameworks such as Bootstrap, Swiper, and Font Awesome Pro. The site demonstrates good mobile optimization and SEO practices, though performance is moderate. Accessibility is basic but functional. The absence of analytics and tracking scripts suggests a privacy-conscious or minimalistic approach. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data or vulnerable libraries. However, it lacks important security headers like Content-Security-Policy and HSTS, and does not provide privacy or cookie policies, which are critical for compliance and user trust. The WHOIS data is unavailable, which reduces domain trustworthiness and raises concerns about registration transparency. Overall, the site is a well-structured, content-rich resource with moderate technical maturity and security posture. The lack of privacy compliance documentation and registrant transparency are notable gaps. Strategic improvements in security headers, privacy policies, and contact transparency would enhance trust and compliance.

15
35
17
60
75
60
100
sportswomenlawnbowlsaustraliaarchival+2 more
WordPress 6.8.1jQuery 3.7.1Bootstrap CSS/JSSwiper+10
2025-07-07T21:39:47.636Z
courtfiling.net favicon

CourtFiling

courtfiling.net

57
TechnologyUnited StatesmediumMEDIUM

CourtFiling.net is an established online platform providing electronic court filing services primarily targeting lawyers and legal professionals across multiple US states including California, Illinois, Indiana, Maryland, and Texas. The website offers a streamlined, secure, and easy-to-use portal for filing court documents electronically, along with additional services such as document conversion, service of process, case summaries, and detailed reporting. The business positions itself as a trusted intermediary between legal professionals and court systems, emphasizing speed, security, and customer support. Technically, the website is built on WordPress CMS and leverages modern web technologies including Google Analytics, Google Tag Manager, Google Optimize for A/B testing, Wistia for video content, and Intercom for live chat support. The site is mobile optimized with good SEO practices and moderate performance. Security is enforced via HTTPS with no visible exposed sensitive data, though security headers are not explicitly detected in the provided data. From a security and compliance perspective, the site lacks visible privacy and cookie policies and does not provide explicit GDPR compliance indicators or security incident response contacts. The WHOIS data for the domain is missing or unavailable, which raises concerns about domain registration legitimacy and reduces trustworthiness. However, the professional presentation, customer testimonials, and active support channels mitigate some of these concerns. Overall, CourtFiling.net demonstrates a solid business and technical foundation with room for improvement in privacy compliance and security transparency. Verification of domain registration and addition of comprehensive privacy and security policies are recommended to enhance trust and compliance.

15
35
2
75
75
80
100
legalcourtfilinge-filinglawtechnology+1 more
Google AnalyticsGoogle Tag ManagerGoogle OptimizeWistia video player+4

Partner Domains:

www.efilinghelp.com
partner
2025-07-07T17:00:47.114Z
circlecountry.com favicon

PowerNation Studios, LLC

circlecountry.com

60
MediaUnited StatesmediumMEDIUM

Circle Country is a media streaming platform specializing in country music and lifestyle entertainment, operated by PowerNation Studios, LLC. The website offers free streaming and on-demand content accessible via multiple popular streaming platforms. The business targets country music fans and lifestyle viewers, positioning itself as a niche media channel within the entertainment industry. The site is professionally designed with consistent branding and clear navigation, supporting a medium-sized business model focused on digital media distribution. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery, Video.js, and Slick Carousel. It leverages AWS Cloudfront CDN for hosting and delivers content with moderate performance and good mobile optimization. SEO is enhanced using the Yoast SEO plugin, and Google Analytics is employed for user tracking. However, accessibility features are basic, and some security best practices like security headers and cookie consent mechanisms are missing. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data in the HTML. Nonetheless, the absence of security headers and lack of published security or incident response policies indicate room for improvement. The WHOIS data is notably missing or unavailable, which raises concerns about domain registration legitimacy despite the active and professional website presence. Overall, the website presents a moderate risk profile with good business credibility but some technical and compliance gaps. Strategic improvements in security headers, privacy compliance, and WHOIS transparency would enhance trust and security posture.

15
53
2
85
67
80
100
countrymusicstreamingmediaentertainmentvideo+2 more
jQueryVideo.jsSlick CarouselYoast SEO
2025-07-07T15:53:03.307Z
G

GemLab

gemlab.co.nz

52
OtherNew ZealandsmallMEDIUM

GemLab is a New Zealand-based independent jewellery valuation service provider specializing in unbiased and expert appraisals of gems, jewellery, and watches. The company holds recognized certifications from the Gemmological Institute of America and the Gemmological Association of Great Britain, positioning itself as a trusted leader in the local market with over 30 years of experience. Their services cater primarily to jewellery owners, insurance companies, legal professionals, and government entities, offering tailored valuation reports including insurance, selling, estate division, and legal purposes. Technically, the website employs a modern and responsive design using Bootstrap, jQuery, and slick carousel for enhanced user experience. It integrates Google Analytics and Facebook Pixel for marketing and tracking purposes, and uses Google reCAPTCHA to secure its contact form against spam. While the site is well-structured and mobile-optimized, it lacks explicit privacy and cookie policies, and security headers are not evident, indicating areas for improvement in compliance and security hardening. From a security perspective, the site benefits from HTTPS encryption and secure form handling but would gain from implementing standard security headers and publishing clear privacy and cookie policies. The absence of WHOIS data is typical for .nz domains with privacy protection and does not detract from the site's legitimacy. Overall, the website presents a professional and trustworthy front with moderate technical maturity and a solid security baseline. The overall risk is low, but strategic enhancements in privacy compliance and security headers are recommended to strengthen trust and regulatory adherence.

35
35
17
60
72
20
100
jewelleryvaluationgemmologyinsurancenewzealand+1 more
BootstrapjQuerySlick CarouselFont Awesome 4.7.0+4
2025-07-07T14:48:14.173Z
campuscu.com favicon

CAMPUS USA Credit Union

campuscu.com

65
FinanceUnited StatesmediumMEDIUM

CAMPUS USA Credit Union is a well-established financial institution based in Florida, providing a broad range of banking, loan, investment, and insurance services primarily to residents and employees in multiple Florida counties. The credit union emphasizes community involvement and member empowerment, positioning itself as a trusted alternative to traditional banks with a community-driven approach. Their market presence is supported by numerous physical branches and a strong digital presence, including online and mobile banking platforms. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, Facebook Pixel, and ASP.NET MVC framework, hosted on AWS infrastructure. The site is mobile-optimized, accessible, and SEO-friendly, with a professional design and clear navigation. Analytics and marketing tools are used responsibly, with moderate user tracking. From a security perspective, the site enforces HTTPS, uses secure login forms, and manages cookies securely. However, it lacks DNSSEC, explicit security headers, and a vulnerability disclosure policy. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. The WHOIS data confirms the domain's legitimacy and long-standing registration, consistent with the business claims. Overall, CAMPUS USA Credit Union's website demonstrates a strong business credibility and technical maturity with minor gaps in privacy compliance and security best practices. Strategic improvements in cookie consent, DNS security, and vulnerability disclosure would enhance trust and compliance.

70
35
2
70
77
75
100
creditunionbankingfinanceloansinvestment+3 more
jQueryGoogle Tag ManagerGoogle AnalyticsFacebook Pixel+3
2025-07-07T13:34:17.646Z
T

Toyota Material Handling Australia

toyotausedforklifts.com.au

65
TransportationAustralialargeMEDIUM

Toyota Material Handling Australia operates a professional website focused on supplying new and used forklifts and skid steer loaders across Australia. The company positions itself as a leading supplier in the material handling sector, offering certified used equipment and a broad range of brands including Toyota, BT, and Raymond. The website is well-structured with clear navigation and relevant content targeting businesses requiring industrial equipment solutions. Technically, the website employs a modern JavaScript stack including jQuery, Google Analytics, Google Tag Manager, and Google reCAPTCHA, indicating a mature digital infrastructure. The site is mobile optimized and uses HTTPS with good SSL configuration, though some security headers are missing. Performance is moderate with room for improvement in accessibility and cookie consent compliance. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and use of CAPTCHA to protect forms. However, the absence of security headers and lack of published security or incident response policies represent areas for enhancement. WHOIS data is limited due to privacy protection, but domain registration appears consistent with the business profile. Overall, the website is professional and trustworthy with moderate risk. Strategic improvements in privacy compliance and security hardening would strengthen the security posture and regulatory adherence.

95
53
2
55
72
60
100
forkliftsusedforkliftsmaterialhandlingindustrialequipmenttoyota+1 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA+4

Partner Domains:

www.toyotaforklifts.com.au
partner
www.toyotaskidsteerloader.com.au
partner
2025-07-07T12:29:11.508Z
shvic.org.au favicon

Sexual Health Victoria

shvic.org.au

60
HealthcareAustraliamediumMEDIUM

Sexual Health Victoria is a well-established non-profit organization dedicated to promoting reproductive and sexual health for Victorians through clinics, education, and advocacy. The organization offers a broad range of services including clinical care, professional learning, school education, and community resources. Their market position is strong within the healthcare and education sectors in Australia, supported by accreditations such as QPA and Rainbow Tick. The website reflects a professional and inclusive brand, targeting a diverse audience including health professionals, educators, youth workers, and the general public. Technically, the website employs a modern technology stack including jQuery, Bootstrap, and various analytics and marketing tools such as Google Analytics, Facebook Pixel, and LinkedIn Insight. The site is hosted with Cloudflare DNS and uses HTTPS with good SSL configuration, ensuring secure communications. Mobile optimization and accessibility are well addressed, and SEO practices are implemented effectively. From a security perspective, the site demonstrates good practices with HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. However, there are areas for improvement such as enabling DNSSEC, implementing a cookie consent mechanism, and publishing a security policy or vulnerability disclosure framework. The WHOIS data aligns with the organization's Australian presence and shows no suspicious patterns, enhancing trustworthiness. Overall, the website is a reliable and professional platform for Sexual Health Victoria, with strong content quality and business credibility. Strategic recommendations include enhancing privacy compliance, improving DNS security, and formalizing security policies to further strengthen the organization's digital security posture.

20
58
17
75
65
65
100
sexualhealthreproductivehealtheducationhealthcarenon-profit+2 more
jQueryBootstrap 4.5.2Slick CarouselGoogle Tag Manager+4
2025-07-07T11:17:46.250Z
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

54
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
salazar.law favicon

Salazar Law

salazar.law

57
FinanceUnited StatessmallMEDIUM

Salazar Law is a specialized boutique law firm based in Miami, Florida, focusing on high-stakes financial restructuring, litigation, cryptocurrency-related legal challenges, and government investigations. The firm has a strong market position with over $1 billion in judgments and settlements and over $10 billion in debt restructured, serving businesses and individuals with complex legal needs. Their key services include strategic restructuring, high-stakes litigation, and cryptocurrency litigation and recovery. The website reflects a professional and consistent brand image targeting business clients in the finance and legal sectors. Technically, the website employs modern web technologies including Google Analytics, Google Tag Manager, Google reCAPTCHA, and the Foundation CSS framework. The site is mobile optimized with good navigation and SEO practices, though performance is moderate. Security posture is solid with HTTPS enforced and use of reCAPTCHA, but lacks some security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, the site shows no critical vulnerabilities or exposed sensitive data. However, the absence of privacy and cookie policies and incident response information indicates compliance gaps. The WHOIS data is unavailable, likely due to privacy protection, which is common and justified for law firms. Overall, the site is trustworthy and professional but would benefit from enhanced transparency and security best practices. Strategically, the firm should prioritize publishing comprehensive privacy and cookie policies, implement security headers, and provide incident response and vulnerability disclosure information to strengthen compliance and trust. Enhancing accessibility and performance would further improve user experience and SEO effectiveness.

30
35
2
70
67
70
100
lawlegalfinancialrestructuringlitigationcryptocurrency+2 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAjQuery+2

Partner Domains:

secure.lawpay.com
partner
www.lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:05.970Z
aiatsis.gov.au favicon

Australian Institute of Aboriginal and Torres Strait Islander Studies

aiatsis.gov.au

63
GovernmentAustraliamediumMEDIUM

The Australian Institute of Aboriginal and Torres Strait Islander Studies (AIATSIS) is Australia's sole national institution dedicated to the history, culture, and heritage of Aboriginal and Torres Strait Islander peoples. It operates as a government-funded entity providing extensive research, educational resources, and cultural heritage services. The website reflects a strong market position as a trusted custodian and leader in Indigenous Australian studies, targeting researchers, educators, Indigenous communities, and the general public. Key services include family history research support, collection access, educational curriculum resources, and cultural heritage repatriation programs. Technically, the website is built on Drupal 10 with modern JavaScript libraries and integrates Google Analytics, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a moderate performance profile. Hosting details are not explicitly stated but the domain is managed by the Australian Department of Finance with DNS via netregistry.net. From a security perspective, the site enforces HTTPS with strong SSL configuration and uses Content Security Policy nonces to mitigate script injection risks. However, DNSSEC is not enabled, and there is no visible cookie consent mechanism or published vulnerability disclosure policy. The WHOIS data confirms the domain is registered to a legitimate government entity with domain status protections, enhancing trustworthiness. Overall, AIATSIS's website is professional, content-rich, and secure, with minor gaps in privacy compliance and vulnerability disclosure. It serves as a reliable digital platform for Indigenous cultural and research engagement in Australia.

70
53
17
65
42
75
100
aboriginaltorresstraitislanderindigenousresearcheducation+3 more
Drupal 10jQuerySlick CarouselGoogle Tag Manager+3

Partner Domains:

shop.aiatsis.gov.au
partner
2025-07-07T07:49:05.059Z
agency8.nl favicon

Agency8 Internet en Marketing Bureau

agency8.nl

64
TechnologyNetherlandssmallMEDIUM

Agency8 Internet en Marketing Bureau is a Dutch digital agency specializing in the development of websites, webshops, custom web applications, and digital marketing services. Founded in 2018, the company positions itself as a trusted digital partner focused on delivering quality, user-friendly, and maintainable online solutions tailored to client needs. Their service portfolio includes strategy, hosting, and specialized Umbraco CMS development, targeting businesses seeking professional online presence and e-commerce capabilities. Technically, the website employs modern web technologies including Bootstrap, jQuery, and various JavaScript libraries, with a responsive design optimized for mobile devices. The presence of structured data and comprehensive meta tags indicates a mature approach to SEO and digital marketing. Hosting and domain registration are managed through Cronon GmbH, a reputable registrar. From a security perspective, the site enforces HTTPS and includes a Content-Security-Policy header, enhancing protection against common web threats. However, DNSSEC is not enabled, and some additional security headers could be implemented to strengthen the security posture. No explicit security policies or incident response contacts are published, which could be improved to enhance trust and compliance. Overall, the website is professional, trustworthy, and well-structured, with clear contact information and social media presence. The lack of cookie consent mechanisms and terms of service pages are minor gaps in privacy compliance. The domain registration data aligns well with the business claims, supporting legitimacy. The site is safe for general audiences with no adult or questionable content detected.

60
68
2
60
75
65
100
internetbureauwebsiteswebshopsmarketingumbraco+2 more
HTML5CSS3JavaScriptjQuery+6
2025-07-07T06:45:37.537Z
davenportslaw.co.nz favicon

Davenports Law

davenportslaw.co.nz

53
Real EstateNew ZealandmediumMEDIUM

Davenports Law is a professional law firm based in North Shore Auckland, New Zealand, specializing in Trust Law, Wills and Estate Law, Commercial Law, and Property Law. The firm targets individuals and businesses seeking tailored legal advice and ongoing support. Their website reflects a well-established regional presence with a medium-sized team and a strong focus on client collaboration and guidance. The site features detailed legal articles, team profiles, testimonials, and affiliations with reputable legal organizations, reinforcing their credibility. Technically, the website employs modern JavaScript libraries such as jQuery, Slick Carousel, and integrates Google Tag Manager, Google Analytics, Facebook Pixel, and LinkedIn Insight Tag for analytics and marketing. The site is mobile-optimized with good SEO practices and a professional design, though some accessibility features are basic. Security-wise, the site uses HTTPS and Google reCAPTCHA for form protection but lacks several recommended security headers, which could be improved to enhance defense against common web attacks. The WHOIS data for the domain is unavailable, which raises some concerns about domain registration transparency. However, the website content and professional presentation strongly suggest legitimacy. No signs of malware or phishing were detected. Privacy policy is present and comprehensive, but no cookie consent mechanism was found despite tracking technologies in use. Overall, the site presents a low risk but would benefit from enhanced security headers and clearer cookie consent to improve compliance and trust. Strategic recommendations include implementing additional security headers, establishing a cookie consent mechanism, and verifying domain registration details to improve trustworthiness and compliance.

35
53
17
80
72
70
20
lawlegaladvicetrustlawpropertylawcommerciallaw+3 more
jQueryjQuery UISlick CarouselGoogle Tag Manager+4
2025-07-07T06:41:56.569Z
C

Cities for Financial Empowerment Fund

cfefund.org

60
GovernmentUnited StatesmediumMEDIUM

Cities for Financial Empowerment Fund (CFE Fund) is a US-based non-profit organization founded in 2011 that supports mayors and local governments across the country by providing grant funding and strategic assistance to embed financial empowerment initiatives in municipal operations. The organization has a strong market position with partnerships in approximately 145 cities, directly supporting over 900,000 residents. Their key services include grant distribution, program development, and impact reporting focused on improving financial stability for city residents. Technically, the website is built on WordPress with a modern tech stack including Gravity Forms for data collection, Google Analytics for tracking, and Cloudflare for DNS management. The site demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. The infrastructure is typical for a mid-sized non-profit organization. From a security perspective, the site uses HTTPS and CAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No exposed sensitive data or vulnerabilities were detected in the HTML content. Privacy compliance is basic, with a privacy policy and terms of service present but no cookie consent mechanism. Contact information is available, but no dedicated security policy or incident response contacts were found. Overall, the website is professional, trustworthy, and safe for general audiences. The security posture is adequate but could be improved with additional DNS and header configurations. The organization’s domain registration is privacy protected, consistent with non-profit practices, and the domain age aligns with the organization's history.

30
53
17
60
75
65
100
non-profitfinancialempowermentgovernmentcitiesgrants+1 more
WordPressGravity FormsGoogle AnalyticsCloudflare DNS+6
2025-07-07T05:34:12.358Z
wiley.law favicon

Wiley Rein LLP

wiley.law

69
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z