Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

151882
Websites
130
Industries
113
Countries
52
Avg Score
Page 481 of 636|Showing 24001-24050 of 31753
scoop.co.nz favicon

Scoop Publishing Ltd

scoop.co.nz

59
MediaNew ZealandmediumMEDIUM

Scoop is an established New Zealand independent news media company, operating since 1996, providing up-to-the-minute news, press releases, analysis, and opinion pieces focused on New Zealand politics, government, and society. The website serves a broad audience including the general public, media professionals, and government stakeholders. It operates a freemium business model with a Pro license required for professional or work-related use, supported by an ethical paywall. The company maintains a network of subsidiary and partner sites covering various news niches and regions within New Zealand. Technically, the website uses modern web technologies including Google Analytics, Google Tag Manager, and Google Publisher Tags for advertising and analytics, with a responsive design optimized for mobile devices. Security posture is good with HTTPS enforced and no visible vulnerabilities, though explicit security headers and privacy compliance mechanisms could be improved. WHOIS data is unavailable, which slightly reduces trustworthiness, but the website's content quality, branding consistency, and external verifications support its legitimacy. Overall, Scoop presents as a credible and professional media outlet with room for enhanced privacy and security transparency.

15
35
25
75
72
70
100
scoopnewsnewzealandnzmedia+2 more
HTML5CSS3JavaScriptGoogle Tag Manager+6

Partner Domains:

werewolf.co.nz
subsidiary
wellington.scoop.co.nz
subsidiary

+3 more partners

2025-07-07T10:09:46.508Z
odt.co.nz favicon

Otago Daily Times

odt.co.nz

64
MediaNew ZealandmediumMEDIUM

Otago Daily Times is a reputable regional news media outlet based in New Zealand, providing comprehensive news coverage for Otago and surrounding regions. The website offers a mix of free and subscription-based premium content, targeting a general audience interested in local and international news. The business operates under the Allied Press group, indicating a stable market position in the media sector. Technically, the site is built on Drupal 7 with modern web technologies including Bootstrap and jQuery, and integrates multiple analytics and advertising platforms such as Google Analytics and Taboola. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Security posture is solid with HTTPS enforced and standard security headers present, though improvements can be made in cookie consent and accessibility. WHOIS data is not publicly available due to .nz domain policies, which limits domain legitimacy verification, but the website content and branding strongly indicate a legitimate and trustworthy entity. Overall, the site scores well on content quality, technical implementation, and business credibility, with moderate privacy compliance and security posture scores.

45
58
17
85
54
70
100
newsmediasubscriptionnewzealandotago+1 more
Drupal 7jQueryBootstrapGoogle Tag Manager+4

Partner Domains:

alliedpress.smedia.com.au
partner
odtshop.co.nz
partner

+1 more partners

2025-07-07T10:09:41.479Z
rulegarza.com favicon

Rule Garza Howley LLP

rulegarza.com

56
GovernmentUnited StatessmallMEDIUM

Rule Garza Howley LLP is a specialized boutique law firm based in Washington, DC, focusing on antitrust legal services. The firm leverages over four decades of experience and a team of former senior antitrust officials to provide sophisticated advice and representation in high-profile matters involving government agencies such as the DOJ and FTC. Their client base primarily consists of multinational corporations requiring expert counsel on M&A, government investigations, and litigation. The firm positions itself as a nimble, responsive, and client-focused legal service provider with a strong market reputation. Technically, the website is built on WordPress and employs modern web technologies including jQuery, Google Analytics, Facebook SDK, and SEO plugins like Yoast. The site is mobile-optimized with good navigation and professional design, reflecting a mature digital presence. Performance is moderate, with room for improvement in accessibility and SEO enhancements. From a security perspective, the site uses HTTPS and integrates standard analytics and social media SDKs securely. However, it lacks explicit security headers and published security or incident response policies. Privacy compliance is minimal, with no visible privacy or cookie policies, which is a notable gap given the data collection via analytics and subscription forms. The WHOIS data is missing or inaccessible, which raises concerns about domain registration transparency despite the professional website content. Overall, the website presents a credible and professional front for the law firm but should address privacy compliance and domain registration transparency to enhance trust and security posture.

15
35
17
75
52
75
100
lawfirmantitrustlegalserviceswashingtondcprofessionalservices
jQueryGoogle AnalyticsFacebook SDKYoast SEO+4
2025-07-07T10:09:01.398Z
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

54
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
mgwl.com favicon

McGill Gotsdiner Workman & Lepp P.C. L.L.O.

mgwl.com

57
OtherUnited StatesmediumMEDIUM

McGill Gotsdiner Workman & Lepp P.C. L.L.O. is a well-established Nebraska-based law firm specializing in corporate, business, estate planning, health care, employment, litigation, and real estate legal services. The firm targets entrepreneurs and businesses seeking comprehensive legal counsel and has been operating since 1975, positioning itself as a trusted regional legal service provider. The website reflects a professional and client-focused approach with detailed attorney profiles and multiple practice areas. Technically, the site is built on WordPress and leverages modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA for security on contact forms. The site is mobile optimized and demonstrates good SEO practices with structured data markup. Security posture is solid with HTTPS enforced and use of CAPTCHA, though explicit security headers are not detected, and privacy compliance could be improved with cookie consent mechanisms. The absence of WHOIS registration data is a notable inconsistency that slightly impacts trust but does not overshadow the professional presentation and content quality. Overall, the website is a credible digital presence for a mid-sized law firm with room for enhancement in privacy and security transparency.

15
35
17
75
52
80
100
lawlegalcorporatebusinessestateplanning+5 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA v3+2

Partner Domains:

www.lawfirmessentials.com
partner
www.paperstreet.com
partner
2025-07-07T10:08:41.355Z
registerplanninglaw.com favicon

Register Law, LLC

registerplanninglaw.com

57
Real EstateUnited StatessmallMEDIUM

Register Law, LLC is a small legal services firm specializing in estate and business planning, trust administration, and prenuptial agreements. The firm positions itself as a thoughtful and personalized planning service provider, emphasizing the client's identity and legacy beyond tax considerations. The website reflects a professional and consistent brand image targeting individuals and businesses in the United States seeking legal planning services. Technically, the website is built on WordPress and uses common web technologies such as jQuery, Google Analytics, and Font Awesome. The site is mobile optimized with good SEO practices but lacks some accessibility features and security headers. Security posture is generally good with HTTPS enforced and no visible vulnerabilities, but the absence of security headers and privacy compliance mechanisms are notable gaps. The WHOIS data is missing, which raises concerns about domain legitimacy and registration status, although the website content and presentation suggest a legitimate business. Contact information is clearly provided with multiple physical addresses and verified company emails and phone numbers. Overall, the website scores moderately well but would benefit from improved privacy compliance and enhanced security practices.

15
35
17
70
72
75
100
estateplanningbusinessplanningtrustadministrationprenuptialagreementslegalservices+1 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle WebFont Loader+1
2025-07-07T10:08:11.280Z
randallmckinneylaw.com favicon

Law Office Randall H. McKinney

randallmckinneylaw.com

54
OtherN/asmallMEDIUM

The Law Office Randall H. McKinney operates as a small legal services provider specializing in trial law and personal injury cases in the Pittsburgh area. The website presents a professional image with clear navigation and detailed practice areas, targeting individuals seeking legal representation in personal injury and criminal defense matters. The business model is focused on providing specialized legal counsel with a local market position. Technically, the website employs common web technologies including Google Analytics and Google Tag Manager for tracking, and uses modern JavaScript libraries for UI elements. The site is moderately optimized for performance and mobile devices, with good SEO practices evident. However, no CMS or hosting provider information is discernible from the data. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and does not provide privacy or cookie policies, which are important for compliance and user trust. The absence of WHOIS registration data is a notable concern, potentially indicating privacy protection or data unavailability, which impacts domain legitimacy assessment. Overall, the security posture is moderate but could be improved with better policy disclosures and security headers. The overall risk is moderate with recommendations to enhance privacy compliance, implement security best practices, and clarify domain registration details to improve trustworthiness and regulatory adherence.

20
35
2
70
77
60
100
legallawyerpersonalinjurytriallawyerpittsburgh+1 more
Google AnalyticsGoogle Tag ManagerFontAwesome
2025-07-07T10:07:31.117Z
younglegalpllc.com favicon

Young Legal, PLLC

younglegalpllc.com

55
Real EstateUnited StatessmallMEDIUM

Young Legal, PLLC is a small law firm based in North Carolina specializing in business law, real estate, and litigation services. The firm targets individuals and businesses primarily in the Raleigh-Durham area, offering legal representation, strategic counsel, and flexible payment options including monthly subscription plans and personal injury consultations. The website presents a professional and consistent brand image with clear contact information and client testimonials, positioning the firm as a trustworthy local legal service provider. Technically, the website is built on WordPress using the PaperStreet theme, hosted on Bluehost, and incorporates modern web technologies such as Google Analytics and Font Awesome. While the site is mobile-optimized and performs moderately well, there are areas for improvement in accessibility and SEO. Security-wise, the site uses HTTPS and domain locks but lacks DNSSEC and important security headers, and does not provide a security policy or incident response information. Privacy compliance is limited, with no cookie consent mechanism and only a basic privacy/disclaimer page. Overall, the website is functional and credible but would benefit from enhanced security and privacy features to improve trust and compliance.

20
35
2
85
72
50
100
lawfirmlegalservicesbusinesslawrealestatelawlitigation+3 more
Google AnalyticsGoogle Tag ManagerjQuerySlick Slider+2

Partner Domains:

secure.lawpay.com
partner
lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:10.979Z
salazar.law favicon

Salazar Law

salazar.law

57
FinanceUnited StatessmallMEDIUM

Salazar Law is a specialized boutique law firm based in Miami, Florida, focusing on high-stakes financial restructuring, litigation, cryptocurrency-related legal challenges, and government investigations. The firm has a strong market position with over $1 billion in judgments and settlements and over $10 billion in debt restructured, serving businesses and individuals with complex legal needs. Their key services include strategic restructuring, high-stakes litigation, and cryptocurrency litigation and recovery. The website reflects a professional and consistent brand image targeting business clients in the finance and legal sectors. Technically, the website employs modern web technologies including Google Analytics, Google Tag Manager, Google reCAPTCHA, and the Foundation CSS framework. The site is mobile optimized with good navigation and SEO practices, though performance is moderate. Security posture is solid with HTTPS enforced and use of reCAPTCHA, but lacks some security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, the site shows no critical vulnerabilities or exposed sensitive data. However, the absence of privacy and cookie policies and incident response information indicates compliance gaps. The WHOIS data is unavailable, likely due to privacy protection, which is common and justified for law firms. Overall, the site is trustworthy and professional but would benefit from enhanced transparency and security best practices. Strategically, the firm should prioritize publishing comprehensive privacy and cookie policies, implement security headers, and provide incident response and vulnerability disclosure information to strengthen compliance and trust. Enhancing accessibility and performance would further improve user experience and SEO effectiveness.

30
35
2
70
67
70
100
lawlegalfinancialrestructuringlitigationcryptocurrency+2 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAjQuery+2

Partner Domains:

secure.lawpay.com
partner
www.lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:05.970Z
livebooks.com favicon

liveBooks

livebooks.com

62
TechnologyUnited StatessmallMEDIUM

liveBooks is a specialized website builder platform targeting creative professionals such as photographers, artists, and real estate agents. Established in 2005, the company offers customizable website templates, SEO tools, video galleries, and customer support, positioning itself as a niche leader in the creative website building market. The website emphasizes ease of use, mobile-friendly design, and professional presentation, supported by client testimonials and a 14-day free trial to attract users. Technically, the website employs a modern but somewhat dated technology stack including jQuery 1.12.4, Bootstrap 4.2.1, Google Analytics, and Typekit fonts. Hosting and domain registration are managed through Amazon Registrar, Inc., indicating reliable infrastructure. The site is mobile-optimized with good SEO practices but lacks some advanced accessibility features and security headers. From a security perspective, the site uses HTTPS and domain registration locks to protect domain integrity. However, it lacks DNSSEC, explicit security headers, and a cookie consent mechanism, which are areas for improvement. No vulnerability disclosures or incident response contacts are found, indicating limited transparency in security operations. Overall, liveBooks presents a professional and trustworthy online presence with solid business credibility and technical implementation. The main risks relate to privacy compliance and security best practices, which if addressed, could enhance user trust and regulatory adherence.

15
58
17
80
62
85
100
websitebuilderphotographycreativeprofessionalsportfolioseo+1 more
jQuery 1.12.4Bootstrap 4.2.1Google AnalyticsTypekit fonts+1
2025-07-07T10:05:50.714Z
G

G.N Carter Builders

gncarterbuilders.co.nz

50
Real EstateNew ZealandsmallMEDIUM

G.N Carter Builders is a small, locally focused building company based in Opononi, New Zealand, specializing in new home construction, renovations, additions, alterations, and maintenance services. The company emphasizes its local roots and certification by the Certified Builders Association of New Zealand, positioning itself as a trusted and experienced builder in the Far North region. The website reflects a professional but modest digital presence hosted on the Weebly platform, with clear service descriptions and contact information. However, the domain WHOIS data is missing, which raises concerns about the domain's registration legitimacy despite the active website content. Technically, the website uses an older version of jQuery and standard Weebly scripts, with Google Analytics and Snowplow for visitor tracking. The site is mobile responsive and has basic SEO and accessibility features but lacks modern security headers and explicit privacy or cookie policies. The absence of WHOIS data and security policies reduces the overall trustworthiness and compliance posture. From a security perspective, the site benefits from HTTPS but suffers from outdated libraries and missing security headers. There is no evidence of incident response or vulnerability disclosure mechanisms. Privacy compliance is minimal, with no cookie consent or GDPR indicators. Overall, the site is functional and safe for general audiences but requires improvements in security, privacy, and domain legitimacy verification. Strategically, the business should prioritize updating its technical stack, implementing comprehensive privacy and security policies, and verifying domain registration to enhance trust and compliance. These steps will improve the company's digital maturity and reduce potential risks associated with outdated technology and unclear domain status.

20
35
2
60
62
60
100
builderconstructionhomerenovationcertifiedbuildernewhomes+3 more
jQuery 1.8.3Google FontsGoogle AnalyticsWeebly/Weebly-based platform+1
2025-07-07T10:05:05.595Z
R

Roose Butcher Builders

roosebutcherbuilders.co.nz

51
Real EstateNew ZealandsmallMEDIUM

Roose Butcher Builders is a family-owned custom home building company operating in South Auckland, New Zealand, specializing in new home construction, renovations, and maintenance services. The company emphasizes nearly two decades of experience and employs qualified builders to ensure high-quality craftsmanship. Their market position is strengthened by membership in Master Builders and the Licensed Building Practitioner certification, providing customers with trust and assurance. The website serves as a professional digital presence showcasing their services, projects, and contact options. Technically, the website is built on the Weebly/EditMySite platform, utilizing common web technologies such as jQuery and Google Analytics. The site is moderately optimized for performance and mobile use but lacks advanced accessibility features and comprehensive SEO optimization. Security practices are basic, with HTTPS implied but no detected security headers or explicit privacy and cookie policies, indicating room for improvement in compliance and security posture. From a security perspective, the site does not expose sensitive data and uses standard analytics tools, but the absence of privacy policies and security incident contacts represents compliance gaps. The lack of WHOIS data limits domain legitimacy verification, which slightly reduces trustworthiness. Overall, the site is functional and professional but would benefit from enhanced security and privacy measures. The overall risk is moderate, with recommendations to implement privacy and cookie policies, improve security headers, verify domain registration, and establish incident response contacts to strengthen trust and compliance.

20
35
2
60
62
60
100
customhomebuildernewhomeshomerenovationssouthaucklandpukekohe+5 more
Google AnalyticsGoogle Tag ManagerjQuery 1.8.3Weebly/EditMySite platform scripts+1
2025-07-07T10:05:00.587Z
S

S & J Mackay Builders

sandjmackaybuilders.co.nz

51
Real EstateNew ZealandsmallMEDIUM

S & J Mackay Builders is a small, award-winning construction company specializing in new home builds and renovations primarily in Wellington, Kapiti Coast, and surrounding regions in New Zealand. The company emphasizes quality craftsmanship and personalized service, managing a limited number of projects annually to ensure attention to detail. Their market position is strong locally, supported by multiple House of the Year awards and certifications such as Registered Master Builder and Licensed Building Practitioner. The website reflects a professional business with clear service offerings and contact information but lacks comprehensive privacy and cookie policies, which are important for compliance and user trust. Technically, the website is built on the Weebly platform using older JavaScript libraries like jQuery 1.8.3, which may introduce security vulnerabilities. The site uses Google Analytics and Tag Manager for tracking, but no advanced security headers or policies are evident. The absence of WHOIS data for the domain raises concerns about domain legitimacy and registration status, although the website content and branding are consistent with a legitimate small business. Security posture is moderate with room for improvement, especially in updating libraries, implementing security headers, and adding privacy compliance documentation. Overall, the site is functional and professional but would benefit from enhanced security and compliance measures to strengthen trust and reduce risk.

20
35
2
60
62
60
100
constructionbuildersnewhomesrenovationsmasterbuilder+3 more
jQuery 1.8.3Google AnalyticsWeebly/Weebly EditMySite platformGoogle Tag Manager+1
2025-07-07T10:04:55.577Z
orao.network favicon

ORAO

orao.network

60
TechnologyIcelandmediumMEDIUM

ORAO Network is a technology company specializing in blockchain oracle services and verifiable randomness functions, supporting multiple blockchains such as Polygon, Solana, and Fuel. Their offerings include zkVRF leveraging zero-knowledge proofs, proactive data rating via neural networks, and pricing oracles. The company targets blockchain developers and enterprises requiring secure, real-time data feeds and randomness. The website reflects a modern, professional digital presence with consistent branding and active social media engagement. Technically, the site uses a Nuxt.js framework with Bootstrap and integrates Google Analytics and reCAPTCHA for user interaction and security. Hosting is behind Cloudflare DNS, but no explicit CMS is detected. Security posture is good with HTTPS and reCAPTCHA, though DNSSEC is not enabled and security headers are not explicitly visible. Privacy compliance is basic with a privacy policy and terms of service present but no cookie consent mechanism. Contact is primarily via a web form with no direct emails or phone numbers published. WHOIS data shows privacy protection typical for tech startups, with domain age consistent with the company's founding in 2020. Overall, the site is professional and trustworthy but could improve in security headers and privacy transparency.

15
53
17
70
75
70
100
blockchainoracleverifiablerandomnesszkvrfcryptocurrency+1 more
Vue.js (Nuxt.js framework)Bootstrap 5Swiper.jsGoogle Analytics+2
2025-07-07T09:01:19.469Z
T

The Australian and New Zealand Institute of Insurance and Finance

anziif.com

74
FinanceAustraliamediumMEDIUM

The Australian and New Zealand Institute of Insurance and Finance (ANZIIF) operates as a leading membership, education, and professional development organization serving the insurance and finance sectors across the Asia-Pacific region. The website reflects a mature business with a clear focus on providing training, compliance solutions, and industry events to professionals. ANZIIF positions itself as a trusted authority with a long operational history dating back to 2005, supported by a well-maintained domain and professional branding. Technically, the website leverages modern web technologies including Bootstrap 4, Sitecore CMS, and integrates multiple analytics and marketing tools such as Google Analytics, Hotjar, Facebook Pixel, and LinkedIn Insight Tag. Hosting and security are managed via Cloudflare, ensuring HTTPS enforcement and domain transfer protection. However, DNSSEC is not enabled, and security headers are minimal, indicating room for improvement in hardening the site against advanced threats. From a security and compliance perspective, the site maintains a good posture with HTTPS and domain locking but lacks explicit cookie consent mechanisms and detailed security policies publicly available. Contact information is primarily provided via web forms rather than direct emails or phone numbers, which may impact user trust and accessibility. The WHOIS data aligns well with the business profile, reinforcing legitimacy and trustworthiness. Overall, ANZIIF's website demonstrates a solid digital presence with professional content and a good security baseline. Enhancements in privacy compliance and security headers would further strengthen its posture and user trust.

85
58
25
82
95
65
100
insurancefinanceeducationprofessionaldevelopmentmembership+1 more
CloudflareGoogle Tag ManagerGoogle AnalyticsHotjar+6
2025-07-07T09:01:09.444Z
pjtra.com favicon

Performance Horizon Group Limited

pjtra.com

60
TechnologyUnited KingdommediumMEDIUM

Pepperjam's Ascend Affiliate Platform is a technology-driven affiliate marketing platform designed to connect brands and publishers for performance-based marketing success. The platform offers end-to-end campaign tracking, reporting, and payment processing, targeting advertisers, publishers, influencers, and agencies. The website reflects a professional and consistent brand presence aligned with its parent company, Performance Horizon Group Limited, based in the United Kingdom. Technically, the site leverages modern web technologies including HubSpot CMS, Dojo Toolkit, and Google Analytics for tracking and performance monitoring. The site is mobile optimized with good SEO practices and a clear navigation structure. However, some technical improvements are recommended, such as implementing security headers and enhancing accessibility features. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. The absence of visible security headers and lack of a published vulnerability disclosure policy or security contact reduces the overall security posture. The missing WHOIS domain registration data raises some concerns about domain legitimacy, although the website content and footer information suggest a legitimate business affiliation. Overall, the website is professional, secure to a reasonable extent, and privacy compliant with clear policies linked. Strategic improvements in security practices and transparency would enhance trust and compliance further.

50
53
2
40
90
70
100
affiliatemarketingperformancemarketingtechnologyplatformadvertiserspublishers+2 more
Google AnalyticsGoogle Tag ManagerDojo ToolkitHubSpot CMS (implied by hs_cos_wrapper classes)

Partner Domains:

www.pepperjam.com
partner
careers-pepperjam.icims.com
partner
2025-07-07T08:56:42.749Z
pjatr.com favicon

Performance Horizon Group Limited

pjatr.com

57
TechnologyUnited KingdomlargeMEDIUM

Pepperjam's Ascend Affiliate Platform, branded as Ascend™ by Partnerize, is a technology-driven affiliate marketing platform designed to connect brands with publishers to drive measurable performance marketing outcomes. The platform offers end-to-end solutions including campaign tracking, reporting, and payment processing, targeting advertisers, publishers, agencies, and influencers globally. The business operates under Performance Horizon Group Limited, a UK-registered entity, positioning itself as a significant player in the affiliate marketing technology sector. Technically, the website leverages modern web technologies including Google Analytics, Google Tag Manager, and the Dojo Toolkit, hosted on a HubSpot CMS platform. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. The website is well-structured with clear navigation and professional design, supporting a positive user experience. From a security perspective, the site uses HTTPS and avoids exposing sensitive data in its HTML content. However, it lacks visible security headers and explicit security policies or incident response information. Privacy compliance is partially addressed through linked privacy and terms pages on the parent domain, but no cookie consent mechanism is present. The absence of WHOIS registration data for the domain raises concerns about domain legitimacy and registration status, which impacts overall trust. Overall, the platform presents a professional and functional affiliate marketing service with moderate technical maturity and security posture. Strategic improvements in domain registration transparency, security headers, privacy compliance, and incident response readiness are recommended to enhance trust and compliance.

50
53
2
40
67
75
100
affiliatemarketingperformancemarketingpartnerizepepperjamadvertisers+1 more
Google AnalyticsGoogle Tag ManagerDojo ToolkitHubSpot CMS

Partner Domains:

www.pepperjam.com
partner
careers-pepperjam.icims.com
partner
2025-07-07T08:56:12.558Z
summer.co.nz favicon

Summer KiwiSaver scheme

summer.co.nz

68
FinanceNew ZealandmediumMEDIUM

Summer KiwiSaver scheme is a New Zealand-based financial service provider specializing in KiwiSaver retirement savings plans. The website offers comprehensive information about various investment options, fund performance, and educational resources targeted at New Zealand residents interested in retirement savings. The business is associated with Forsyth Barr, a known financial services company in New Zealand, indicating a credible market position within the KiwiSaver sector. The website is built on Silverstripe CMS and integrates modern tracking and analytics tools such as Google Tag Manager, Google Analytics, and Facebook Pixel, reflecting a moderate level of digital maturity. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. Security posture is adequate with HTTPS usage and asynchronous loading of tracking scripts; however, the absence of security headers and explicit privacy and cookie policies indicates room for improvement. The lack of WHOIS data for the domain reduces trustworthiness from a domain registration perspective, though the website content and business association suggest legitimacy. Overall, the site scores moderately well on content quality, technical implementation, and business credibility but needs enhancements in privacy compliance and security best practices.

100
53
2
60
77
80
100
kiwisaverfinanceinvestmentretirementnewzealand+1 more
Silverstripe CMS 5.3Google Tag ManagerGoogle AnalyticsFacebook Pixel+3
2025-07-07T07:54:00.900Z
alm.com favicon

ALM Global, LLC

alm.com

73
MediaUnited StateslargeMEDIUM

ALM Global, LLC operates a comprehensive media and intelligence platform focused primarily on the legal industry, delivering data, insights, marketing solutions, and events to a global audience of business leaders and practicing professionals. The company positions itself as a leading authority in the business of law, supported by a heritage of over 100 years and a strong digital presence. The website is professionally designed, content-rich, and optimized for user engagement, targeting legal professionals and related sectors. Technically, the website is built on WordPress with modern plugins and integrations including Yoast SEO, Tealium tag management, and Google Analytics. The site demonstrates good mobile optimization and SEO practices, though some accessibility features could be enhanced. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security headers and publicly available security policies or incident response information. Overall, the site reflects a mature digital infrastructure with moderate to good security and privacy compliance. The absence of WHOIS data due to privacy protection is typical for media companies and does not detract from the site's legitimacy. The business credibility is supported by consistent branding, social media presence, and clear market positioning. Recommendations include improving security headers, publishing security policies, and enhancing accessibility to further strengthen trust and compliance.

90
68
17
80
65
85
100
medialegalbusinessintelligenceevents+2 more
WordPress 6.7.1Google FontsjQueryYoast SEO plugin+4
2025-07-07T07:51:55.602Z
F

Federal Reserve History

federalreservehistory.org

69
GovernmentUnited StatesmediumMEDIUM

FederalReserveHistory.org is an authoritative educational website dedicated to providing comprehensive historical information about the Federal Reserve System. It offers essays, timelines, and biographies aimed at researchers, students, and the general public interested in the Federal Reserve's history and policy. The site positions itself as a trusted resource with consistent branding and professional content, serving a medium-sized audience primarily in the United States government and finance sectors. Technically, the website employs modern frameworks such as Bootstrap 5 and integrates Google Analytics and Tag Manager for tracking. The site is mobile-optimized and has good SEO practices, though accessibility could be improved. From a security perspective, the site enforces HTTPS and uses secure form inputs but lacks some security headers and explicit security policies or incident response information. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with a clear privacy policy but no cookie consent mechanism. WHOIS data is unavailable due to a malformed request, but the domain appears legitimate based on content and update timestamps. Overall, the website demonstrates a strong security posture with room for improvement in privacy and security transparency. The risk assessment indicates a low risk for users, with no adult or questionable content present. Strategic recommendations include implementing cookie consent, adding security headers, publishing security policies, and enhancing accessibility. These improvements would further strengthen trust and compliance while maintaining the site's authoritative position in Federal Reserve historical education.

90
53
2
70
70
85
100
federalreservehistoryfinancegovernmenteducation
Bootstrap 5Font AwesomeGoogle Tag ManagerGoogle Analytics
2025-07-07T07:51:20.424Z
frbservices.org favicon

Federal Reserve Banks

frbservices.org

73
FinanceUnited StatesenterpriseMEDIUM

The Federal Reserve Financial Services website represents the official online presence of the Federal Reserve Banks' financial services division. It provides comprehensive information and access to a wide range of financial services targeted primarily at depository institutions and banks. The site highlights key services such as electronic fund transfers, check collection, cash and coin distribution, and newer offerings like the FedNow Service. The Federal Reserve Banks hold a dominant market position as the central banking authority in the United States, and this website serves as a critical resource for their institutional customers. Technically, the website employs a modern technology stack including Bootstrap for responsive design, jQuery, and integrates multiple analytics tools such as Google Analytics and LinkedIn Insight Tag. The site is mobile-optimized and accessible, with good SEO practices evident in meta tags and structured navigation. Hosting and DNS services are provided by reputable providers, and the domain is well-established with a creation date in 1998. From a security perspective, the site enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, it lacks DNSSEC and certain security headers that could enhance protection. There is no publicly available security policy or incident response information, nor a vulnerability disclosure program. Privacy compliance is basic, with a clear privacy policy but no cookie consent mechanism detected. The use of privacy protection in WHOIS is justified given the nature of the organization. Overall, the website is professional, trustworthy, and well-maintained, with a strong business credibility score. Recommendations include enabling DNSSEC, adding security headers, publishing security policies, and implementing a vulnerability disclosure mechanism to further strengthen security posture and compliance.

80
53
10
70
100
85
100
federalreservefinancialservicesbankingfedwirefedach+4 more
Google AnalyticsGoogle Tag ManagerjQueryBootstrap+2
2025-07-07T07:51:05.396Z
dallasfed.org favicon

Federal Reserve Bank of Dallas

dallasfed.org

69
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of Dallas website serves as the official digital presence of one of the twelve regional Reserve Banks in the United States. It provides authoritative economic research, data, community development initiatives, banking supervision resources, and educational materials targeted at economists, policymakers, bankers, and the public within the Eleventh Federal Reserve District. The site is well-branded, professionally designed, and offers comprehensive content that supports its role as a government entity within the Federal Reserve System. Technically, the website employs modern web technologies including Bootstrap for responsive design, Google Analytics and Tag Manager for user tracking, and embeds multimedia content via Vimeo. The site is mobile-optimized and accessible, with clear navigation and SEO best practices. However, some security best practices such as explicit security headers and cookie consent mechanisms could be improved. From a security perspective, the site uses HTTPS exclusively and does not expose sensitive data in its HTML content. The absence of WHOIS data due to a malformed WHOIS response limits domain registration insights, but the strong official branding and consistent content quality support its legitimacy. No WAF or blocking mechanisms were detected, allowing full content access. Overall, the website demonstrates a strong security posture and high business credibility, with minor areas for improvement in privacy compliance and security header implementation. The risk level is low, and the site is trustworthy for its intended audience.

65
53
2
70
95
85
100
federalreserveeconomybankingtexasenergy+3 more
Google AnalyticsGoogle Tag ManagerBootstrap (CSS/JS)jQuery+1
2025-07-07T07:51:00.378Z
F

Federal Reserve Bank of Kansas City

kansascityfed.org

45
FinanceUnited StateslargeHIGH

The Federal Reserve Bank of Kansas City website serves as an official portal for the Tenth Federal Reserve District, providing central banking services, economic research, and community development support. The site targets financial institutions, economists, policymakers, and community organizations. It is part of the larger Federal Reserve System, positioning it as a key regional financial institution within the United States. Technically, the website utilizes the Sitecore CMS platform and integrates common analytics and tracking tools such as Google Analytics, Google Tag Manager, and Crazy Egg. The performance and mobile optimization are moderate to basic, with room for improvement in accessibility and SEO. The site lacks visible privacy and cookie policies, which impacts privacy compliance scoring. From a security perspective, the site uses HTTPS but lacks visible security headers and explicit security policies or incident response contacts. The WHOIS data is unavailable due to a malformed response, but the domain appears legitimate given its .org TLD and consistent branding. No vulnerabilities or suspicious patterns were detected in the provided content. Overall, the website is professional and trustworthy but would benefit from enhanced privacy disclosures, security headers, and clearer contact information to improve compliance and security posture.

-
35
2
70
-
85
100
financegovernmentfederalreserveeconomicresearchbanking
Google AnalyticsGoogle Tag ManagerCrazy Egg
2025-07-07T07:50:45.347Z
lbresearch.com favicon

Law Business Research

lbresearch.com

71
TechnologyUnited KingdomlargeMEDIUM

Law Business Research (LBR) is a UK-based technology-driven information services company specializing in providing intelligence and insights to the global legal, intellectual property, and governance, risk, and compliance markets. The company offers a range of platforms and tools designed to help legal professionals, law firms, corporates, academics, and government agencies make informed decisions through data-driven insights. LBR positions itself as a fast-growing and innovative leader in its sector, serving a diverse and international client base including major law firms and FTSE100 companies. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics. The presence of Cloudflare bot management cookies suggests a robust hosting and security infrastructure. The site is mobile-optimized and demonstrates good performance and accessibility standards, although some security headers could be improved. Privacy compliance is well addressed with clear cookie consent mechanisms and comprehensive privacy and cookie policies. From a security perspective, the site enforces HTTPS and employs cookie consent blocking for scripts until user approval. However, it lacks explicit security policy documentation and incident response contacts, which are recommended for enhanced trust and compliance. The absence of WHOIS registration data raises minor concerns but does not critically impact the overall legitimacy given the professional presentation and business information. Overall, LBR's website reflects a mature digital presence with strong business credibility and compliance posture, suitable for its professional audience. Strategic improvements in security transparency and WHOIS registration clarity would further enhance trust and security posture.

60
80
17
80
65
80
100
legalresearchintelligencetechnologycompliance+4 more
WordPressYoast SEO pluginjQueryCloudflare (inferred from cookie __cf_bm)+3
2025-07-07T07:50:35.256Z