Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 33 of 1064|Showing 1601-1650 of 53176
ruralretreats.co.uk favicon

Rural Retreats

ruralretreats.co.uk

70
HospitalityUnited KingdommediumMEDIUM

Rural Retreats is a UK-based holiday cottage rental platform offering over 920 self-catering luxury cottages across the United Kingdom. The company targets families and couples seeking idyllic holiday accommodations, positioning itself as a reputable and established player in the UK hospitality sector. The website provides comprehensive information about its offerings, supported by customer reviews and a professional online presence. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, Cookiebot for consent management, and New Relic for performance monitoring. It integrates multiple third-party analytics and marketing tools, ensuring good digital maturity and performance. The site is mobile-optimized and uses HTTPS with appropriate security headers, reflecting a solid technical foundation. From a security perspective, the website demonstrates good practices such as enforcing HTTPS, implementing cookie consent mechanisms, and using reCAPTCHA. However, it lacks publicly available security policies and incident response information, which could be improved to enhance transparency and trust. The absence of WHOIS data due to domain naming rules error is a notable anomaly but does not detract significantly from the overall legitimacy based on website content. Overall, Rural Retreats presents a trustworthy and professional online platform with moderate to strong security and privacy compliance. Strategic improvements in publishing security policies and incident response details, along with resolving domain registration transparency, would further strengthen its risk posture and stakeholder confidence.

75
100
72
65
17
88
60
holidaycottagesuktravelself-cateringvacationrentalsfamilyholidays+3 more
jQuery 3.6.0jQuery UI 1.13.3Google Tag ManagerGoogle Analytics+4
2026-07-03T07:16:36.994Z
D

DLL

delagelanden.com

75
FinanceN/alargeMEDIUM

DLL is a global vendor finance partner specializing in providing tailored financial solutions to equipment and technology manufacturers, distributors, and dealers across more than 30 countries. The company offers a range of services including commercial finance, retail finance, and used equipment finance, positioning itself as a leader in the vendor finance market with over 55 years of experience. Affiliated with the Rabobank Group, DLL benefits from strong financial backing and reputable credit ratings from Moody’s and Standard & Poor’s. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content aimed at business clients seeking financing solutions. From a technical perspective, the website employs modern technologies such as Bootstrap 4, Google Tag Manager, and OneTrust for cookie consent management, indicating a commitment to user experience and privacy compliance. The site is mobile-optimized and accessible, with good SEO practices evident in meta tags and structured navigation. Security posture is solid with HTTPS enforced and cookie consent implemented, though some security headers could be improved for enhanced protection. The security evaluation reveals no critical vulnerabilities or exposed sensitive data. However, the absence of explicit security policies or incident response contacts suggests room for improvement in transparency and readiness. The WHOIS data is not publicly available, likely due to privacy protection, which is common for financial institutions but reduces domain registration transparency. Overall, the website demonstrates a high level of professionalism and trustworthiness suitable for its business sector. Strategically, DLL should consider publishing detailed security policies and incident response information to bolster trust further. Enhancing security headers and maintaining regular audits of third-party scripts will strengthen the security posture. Continued focus on priva…

67
90
80
100
90
88
2
financevendorfinanceleasingcommercialfinanceretailfinance+2 more
Bootstrap 4Google Tag ManagerOneTrust Cookie ConsentjQuery (implied by Bootstrap usage)+1

Partner Domains:

rabobank.com
parent
2026-07-03T07:15:20.897Z
G

GDS Instruments (A division of Global Digital Systems Ltd)

gdsinstruments.com

51
ManufacturingUnited KingdommediumMEDIUM

GDS Instruments, a division of Global Digital Systems Ltd, is a UK-based manufacturer specializing in soil and rock testing apparatus and related software for geotechnical and earthquake engineering applications. The company targets professionals and institutions in geotechnical engineering, offering a broad portfolio of testing equipment and technical support services. Their market position is that of a specialist manufacturer with a strong focus on quality and technical expertise. Technically, the website is built on ASP.NET WebForms with Bootstrap for responsive design, integrating modern analytics tools such as Google Analytics and LinkedIn Insight. The site is mobile-optimized and presents a professional user experience, although some accessibility features could be improved. The performance is moderate, with no critical technical issues detected. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA for form protection, but lacks several security headers and explicit security or incident response policies. The absence of WHOIS domain registration data is a notable concern, impacting trust and legitimacy assessments. Privacy and cookie policies are present, but the lack of a cookie consent mechanism reduces GDPR compliance confidence. Overall, the website is professional and trustworthy in content and presentation but would benefit from improved transparency in domain registration, enhanced security headers, and stronger privacy compliance mechanisms to reduce risk and increase stakeholder confidence.

57
70
40
80
2
15
68
soiltestingrocktestinggeotechnicalengineeringmaterialtestingearthquakeengineering+2 more
jQueryGoogle AnalyticsGoogle Tag ManagerreCAPTCHA+2
2026-07-03T07:14:07.776Z
B

Baker Ross

bakerross.co.uk

70
RetailUnited KingdomlargeMEDIUM

Baker Ross is a UK-based e-commerce retailer specializing in arts and crafts supplies, seasonal and themed craft kits primarily targeting children, schools, and educators. The company maintains a strong market position in the retail and educational craft supply sector with a broad product range and next day delivery service within the UK. The website demonstrates a mature digital presence with integrations of advanced search, marketing, and analytics tools, supporting a data-driven approach to customer engagement and sales. Technically, the website is built on the Magento platform, leveraging RequireJS and multiple third-party services such as Klevu Search, Klaviyo, and Microsoft Clarity for enhanced user experience and marketing analytics. The site is mobile optimized and shows good SEO practices, although some security headers could be improved for enhanced protection. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security policy and incident response information publicly. No critical vulnerabilities or exposed sensitive data were detected in the analysis. Privacy compliance is well addressed with GDPR-aligned policies and cookie management. Overall, Baker Ross presents a trustworthy and professional online retail platform with a strong focus on customer experience and compliance. Strategic improvements in security headers and public security documentation would further enhance their security maturity and customer trust.

70
59
100
85
70
73
17
artscraftssuppliescraftkitschildreneducation+2 more
RequireJSKlevu SearchGoogle Tag ManagerMicrosoft Clarity+5

Partner Domains:

bakerross.de
partner
bakerross.fr
partner

+3 more partners

2026-07-03T07:13:51.017Z
samltd.co.uk favicon

Sands Agricultural Machinery

samltd.co.uk

62
ManufacturingUnited KingdomsmallMEDIUM

Sands Agricultural Machinery is a UK-based family-run manufacturer specializing in self-propelled agricultural sprayers with tank capacities ranging from 3,000L to 6,000L. The company emphasizes durable UK-built machinery, practical design, and trusted customer support. Their market position is that of a niche manufacturer serving farmers and agricultural businesses, with a focus on quality and personal service. The website reflects this with detailed product information, customer testimonials, and clear contact options. Technically, the website is built on the Webflow platform, leveraging modern web technologies including Google Tag Manager, Google reCAPTCHA, and Finsweet cookie consent tools. The site is mobile-optimized and performs moderately well, with good SEO and accessibility basics. Security posture is solid with HTTPS enforced and use of CAPTCHA on forms, though explicit security headers and published security policies are lacking. The WHOIS data for the domain is incomplete and indicates a domain naming rule violation, suggesting the domain may be a subdomain or alias rather than a fully registered domain. Despite this, the website content and business information appear legitimate and professional. Privacy and cookie policies are comprehensive and GDPR compliant, with active consent mechanisms. Overall, the site presents a trustworthy and professional front for a small UK manufacturing business, though improvements in domain registration transparency and security policy publication are recommended.

70
70
100
54
88
2
30
agriculturalmachineryselfpropelledsprayersukmanufacturerfamilybusinessagriculture+1 more
WebflowGoogle Tag ManagerGoogle reCAPTCHAjQuery+3
2026-07-03T07:13:28.292Z
texasmutual.com favicon

Texas Mutual Insurance Company

texasmutual.com

69
GovernmentUnited StateslargeMEDIUM

Texas Mutual Insurance Company operates as the leading workers' compensation insurance provider in Texas, serving over 80,000 businesses and 1.5 million workers. The company emphasizes strong community ties, safety resources, and policyholder dividends, positioning itself as a trusted partner for Texas employers. The website reflects a mature digital presence with comprehensive content tailored to multiple user groups including employers, agents, healthcare providers, and injured workers. Technically, the site leverages modern frameworks such as Bootstrap and Webflow CMS, integrates multiple marketing and analytics tools, and maintains good mobile optimization and accessibility standards. Security posture is strong with HTTPS enforced and secure login portals, though explicit security headers and vulnerability disclosure policies are absent. Privacy compliance is partial, with a clear privacy policy but lacking cookie consent mechanisms. WHOIS data is unavailable, which is unusual for a major insurer, but the website's branding and external references strongly support legitimacy. Overall, the site demonstrates a professional, secure, and user-friendly platform with room for improvement in privacy and security transparency.

77
85
80
100
60
65
2
workerscompensationinsurancetexasemployerssafety+3 more
jQuery 3.4.1Bootstrap 4.3.1Google Fonts (Montserrat, IvyPresto)FontAwesome 6.5.2+9

Partner Domains:

app.texasmutual.com
service
secure.texasmutual.com
service

+2 more partners

2026-07-03T07:12:04.096Z
reviso.com favicon

Reviso Cloud Accounting Limited

reviso.com

73
TechnologyUnited KingdommediumMEDIUM

Reviso Cloud Accounting Limited operates a professional website offering cloud-based bookkeeping and accounting software tailored for small and medium-sized enterprises (SMEs), accounting practices, and self-employed professionals. The company provides a comprehensive suite of services including invoicing, bank reconciliation, asset management, and project accounting, positioning itself as a complete cloud accounting solution in the UK market. The website is well-structured, visually appealing, and optimized for user experience with clear navigation and mobile responsiveness. Technically, the website employs modern web technologies such as Google Tag Manager, Google Analytics, jQuery, and various UI libraries to enhance functionality and tracking. The site enforces HTTPS with strong SSL configuration and implements security headers, reflecting a good security posture. Privacy compliance is evident through detailed privacy and cookie policies, along with a consent mechanism, aligning with GDPR requirements. However, the WHOIS data for the domain is missing or inaccessible, which raises questions about domain registration transparency. No explicit security policy or incident response information is published, and there is no vulnerability disclosure or security.txt file available. These gaps suggest areas for improvement in security communication and transparency. Overall, the website presents a trustworthy and professional front for its cloud accounting services, but the domain registration opacity and lack of published security policies warrant cautious monitoring and potential enhancements in security governance and disclosure.

72
65
100
75
70
100
17
cloudaccountingbookkeepingsoftwaresmeaccountinginvoicingsoftwarefinancialreports+3 more
Google Tag ManagerGoogle AnalyticsjQuerySelect2+4
2026-07-03T07:10:00.337Z
K

Kingston Cleaning Services

kingstoncleaningservices.co.uk

51
OtherUnited KingdommediumMEDIUM

Kingston Cleaning Services (KCS) is a UK-based commercial and industrial cleaning company specializing in a wide range of interior and exterior cleaning services across Yorkshire and the UK. The company serves diverse sectors including commercial, industrial, and domestic clients, offering services such as building fabric cleaning, window cleaning, pressure washing, and high-level cleaning. KCS emphasizes health and safety, with trained teams and strong site compliance, positioning itself as a reliable and reputable cleaning partner with over 70 years of combined experience in the industry. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site is mobile-optimized with good navigation and content structure, though some security headers could be improved. The website uses HTTPS and reCAPTCHA for form security, reflecting a moderate to good security posture. Security-wise, the site demonstrates good practices including HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. However, it lacks explicit incident response contacts and a vulnerability disclosure policy, which are recommended for enhanced security maturity. Privacy and cookie policies are present and appear GDPR compliant, supporting privacy compliance. Overall, the website is professional, trustworthy, and well-maintained, though the WHOIS data is unavailable due to domain registration lookup issues. This does not detract from the legitimacy of the business, but it is recommended to verify domain registration details through alternative means. Strategic improvements in security headers and incident response transparency would further strengthen the security posture.

40
70
60
57
17
15
68
cleaningcommercialcleaningindustrialcleaningwindowcleaningpressurewashing+3 more
WordPressYoast SEOGoogle Tag ManagerGoogle Analytics+2
2026-07-03T07:09:43.497Z
gfelectrical.co.uk favicon

GF Electrical

gfelectrical.co.uk

50
EnergyUnited KingdommediumMEDIUM

GF Electrical is a well-established electrical contracting company based in Dorset, UK, with a domain age dating back to 2004. The company offers a broad range of electrical services including commercial, industrial, residential electrical work, fire alarms, emergency lighting, and EV charging solutions. Their market position is strong within the South of England, supported by long-term client relationships and multiple industry accreditations such as ECA, BAFE, NICEIC, and SafeContractor. The website reflects a professional business model focused on service delivery to domestic, commercial, and industrial sectors. Technically, the website is built on WordPress using popular plugins and tools such as WPBakery Page Builder, Gravity Forms, and integrates analytics and marketing tools including Google Analytics, Google Tag Manager, Facebook Pixel, Smartlook, and Tawk.to live chat. The site is mobile optimized with good SEO practices and moderate performance. Hosting and domain registration are managed via Cloudflare, providing a reliable infrastructure. From a security perspective, the site uses HTTPS and some security best practices but lacks explicit security headers and a published security or incident response policy. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is partial; a cookie policy with consent mechanism is present, but no privacy policy page was found, representing a compliance gap. Contact information is clearly provided, enhancing business credibility. Overall, GF Electrical's website presents a trustworthy and professional digital presence with room for improvement in privacy policy publication and security header implementation. The risk level is low, but addressing compliance gaps and enhancing security posture would strengthen trust and regulatory adherence.

100
55
-
65
17
15
65
electricalcontractorsfirealarmscommercialelectricalindustrialelectricalresidentialelectrical+5 more
WordPressWPBakery Page BuilderGravity FormsjQuery+5
2026-07-03T07:09:04.324Z
crowncastle.com favicon

Crown Castle

crowncastle.com

61
TelecommunicationsUnited StatesenterpriseMEDIUM

Crown Castle is a leading telecommunications infrastructure provider in the United States, specializing in shared communications infrastructure such as cell towers, small cells, and fiber networks. The company positions itself as the nation's largest provider in this sector, targeting wireless carriers, public sector entities, industrial enterprises, property owners, and investors. Their business model focuses on leasing and managing infrastructure assets to enable wireless connectivity nationwide. The website reflects a mature enterprise with comprehensive service offerings and a strong market presence. Technically, the website employs a modern technology stack including Vue.js, jQuery, and integrates multiple marketing and analytics platforms such as Google Analytics, Microsoft Clarity, Hotjar, and Marketo. The site is mobile-optimized, accessible, and SEO-friendly, with fast to moderate performance. The use of reputable third-party services and secure form handling indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses secure form submissions. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not evident in the HTML source, suggesting room for improvement. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The WHOIS data is unavailable, likely due to privacy protection, but the website's professionalism and consistency support its legitimacy. Overall, Crown Castle's website demonstrates a strong business and technical foundation with good security practices. Recommendations include enhancing security headers, publishing an incident response policy, and adding a vulnerability disclosure program to further strengthen trust and security posture.

80
100
85
47
17
15
58
telecommunicationsinfrastructurecelltowerssmallcellsfiber+3 more
jQuery 3.6.3Vue.js 2Marketo FormsGoogle Tag Manager+10

Partner Domains:

investor.crowncastle.com
subsidiary
2026-07-03T07:08:36.245Z
commercial-properties-scotland.co.uk favicon

James Keiller Property Holdings Ltd

commercial-properties-scotland.co.uk

58
Real EstateUnited KingdommediumMEDIUM

James Keiller Property Holdings Ltd is a privately owned property development, investment, and management company based in Dundee, Scotland, established in 1981. The company focuses on residential and commercial property projects across Scotland, with a strong presence in Tayside and the central belt. Their services include land sourcing, planning, project management, construction, acquisition, and disposal, targeting landowners, financial institutions, and local authorities. The website presents a professional image with clear contact details and partner affiliations but lacks key compliance documents such as privacy and cookie policies. Technically, the site is built on WordPress with Elementor and uses Google Analytics and Tag Manager for tracking. Security posture is adequate with HTTPS enabled and secure forms, but missing security headers and absence of incident response or security policies reduce maturity. The WHOIS data is missing or unavailable, which raises concerns about domain legitimacy despite the professional website content. Overall, the site is functional and business-appropriate but would benefit from improved transparency and security practices.

72
65
100
70
35
2
45
propertydevelopmentrealestateinvestmentcommercialpropertyresidentialproperty+2 more
WordPressElementorjQueryGoogle Tag Manager+1

Partner Domains:

zoopla.co.uk
partner
lettingweb.com
partner
2026-07-03T07:07:15.142Z
W

Wrigleys Solicitors LLP

wrigleys.co.uk

64
OtherUnited KingdommediumMEDIUM

Wrigleys Solicitors LLP is a well-established specialist law firm operating primarily in the UK with offices in Leeds, Sheffield, and Newcastle. The firm focuses on advising private clients, charities, trustees, and businesses in sectors such as trusts, tax, pensions, property, agriculture, education, and employment law. Their market position is reinforced by multiple industry certifications and recognitions, including Legal 500 and Chambers rankings. The website reflects a professional and comprehensive digital presence with clear navigation and rich content tailored to their target audience. Technically, the website employs modern web technologies including jQuery, Bootstrap, Google Analytics, Google Tag Manager, and Google reCAPTCHA for security on forms. The site is mobile-optimized and demonstrates good SEO practices. While no explicit CMS or hosting provider was identified, the infrastructure appears stable and performant. From a security perspective, the site uses HTTPS with a strong SSL configuration and implements cookie consent and CAPTCHA mechanisms to protect user data and prevent abuse. However, security headers are not explicitly detected and no public security or incident response policies are found, indicating room for improvement in transparency and defense-in-depth. Overall, the website is trustworthy and professional with no signs of malicious activity or content safety concerns. The lack of WHOIS data due to domain query failure limits full domain legitimacy verification, but the business credentials and content strongly support authenticity. Strategic recommendations include enhancing security headers, publishing incident response information, and continuous monitoring of third-party scripts.

57
85
70
100
30
68
17
lawlegalsolicitorstrustspensions+4 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA+5
2026-07-03T07:06:52.756Z
coupesandconvertibles.co.uk favicon

Coupes and Convertibles Ltd

coupesandconvertibles.co.uk

56
TransportationUnited KingdomsmallMEDIUM

Coupes and Convertibles Ltd operates a specialized vehicle sales business focused on campervans and leisure vehicles in the Berkshire region of the United Kingdom. The company offers a range of new, used, and pre-registered vans, including hand-built campervan conversions with sustainable off-grid electrical packages. Their market position is that of a niche local dealer with a strong emphasis on multifunctional campervans suitable for both leisure and mobile office use. The website reflects a small-sized business with a professional online presence, FCA regulation, and customer trust signals such as testimonials and clear contact information. Technically, the website is built on WordPress with modern web technologies including Yoast SEO, Google Tag Manager, Google Analytics, and Typekit fonts. The site is hosted with CDN support (Cloudfront) and uses HTTPS with good SSL configuration. Performance and mobile optimization are good, though accessibility features are basic. SEO is well implemented with proper meta tags and structured data. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism compliant with GDPR. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not detected, and no security.txt or incident response information is provided. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data query for the 'www' subdomain failed due to domain naming rules, but the main domain is active and consistent with the business claims. Overall, the website presents a trustworthy and professional business with a solid technical foundation and good privacy compliance. The main risk areas include incomplete WHOIS data, lack of explicit security headers, and absence of formal security policies or vulnerability disclosure channels. Strategic improvements in these areas would enhance the security posture and trustworthiness further.

70
100
27
60
30
80
2
campervanvehiclesaleswokinghamberkshirefinance+2 more
WordPressYoast SEOjQueryGoogle Tag Manager+3

Partner Domains:

dragon2000.co.uk
partner
2026-07-03T07:00:37.126Z
C

CloudNine Creative Interiors

descabusinessfurniture.co.uk

59
Real EstateUnited KingdomsmallMEDIUM

CloudNine Creative Interiors is a UK-based bespoke interior design and furniture manufacturing company specializing in high-quality office and residential furniture. The company emphasizes craftsmanship with over 70 years of combined experience and holds accreditations for specialized materials such as Corian and Krion. Their market position is that of a niche provider catering to both corporate and private clients, offering full design consultancy and installation services. The website reflects a professional and consistent brand image with clear contact details and customer testimonials, enhancing trustworthiness. Technically, the website is built on the itseeze CMS platform and employs modern web technologies including Google Analytics and Tag Manager for minimal user tracking. The site is mobile-optimized with responsive design scripts and good SEO practices. Performance is moderate, and accessibility is basic but functional. Security posture is solid with HTTPS enforced and cookie consent implemented, though security headers and advanced policies are lacking. The security evaluation reveals no critical vulnerabilities or exposed sensitive data. However, the absence of security headers and a formal incident response or vulnerability disclosure policy are areas for improvement. Privacy compliance is adequate with clear privacy and cookie policies and GDPR consent mechanisms in place. WHOIS data could not be extracted due to a query error on the 'www' subdomain, but the domain appears legitimate and consistent with the business branding. Overall, the website presents a low-risk profile with good business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing a security policy, and improving accessibility to further strengthen the security posture and compliance framework.

60
70
37
100
60
2
68
interiordesignbespokefurnitureofficefurniturecommercialinteriorsresidentialinteriors+2 more
Google AnalyticsGoogle Tag ManagerCustom JavaScriptResponsive design scripts
2026-07-02T07:27:08.145Z
hillierjewellers.co.uk favicon

Hillier Jewellers

hillierjewellers.co.uk

67
RetailUnited KingdommediumMEDIUM

Hillier Jewellers is a UK-based online retailer specializing in fashion jewellery and giftware, offering quality products at competitive prices with promotional incentives such as discounts for first orders. The company targets a broad general audience interested in jewellery and watches, operating primarily through an e-commerce platform. The website demonstrates a solid digital presence with integrated customer reviews and active social media channels, supporting its market position as a reputable retailer in the UK jewellery sector. Technically, the website employs modern web technologies including JavaScript libraries, Google Analytics, and Facebook Pixel for marketing and analytics purposes. The site is mobile-optimized and exhibits good SEO and accessibility practices, although some accessibility features could be enhanced. Security-wise, the site enforces HTTPS, includes standard security headers, and avoids exposing sensitive data, reflecting a good security posture. However, the absence of a public security policy and incident response information suggests room for improvement in transparency and preparedness. The WHOIS data retrieval failed due to domain naming issues, which limits full verification of domain legitimacy, but the active and professional website presence supports its credibility. Overall, Hillier Jewellers presents a trustworthy and well-maintained online retail platform with moderate technical maturity and a good security baseline.

74
100
60
65
73
70
17
jewellerye-commercefashionretailuk
JavaScriptGoogle AnalyticsFacebook PixelGoogle Tag Manager+2
2026-07-02T07:26:13.874Z
riverlearningtrust.org favicon

River Learning Trust

riverlearningtrust.org

70
EducationUnited KingdomlargeMEDIUM

River Learning Trust is a well-established multi-academy trust managing 30 schools and educational services in Oxfordshire and Swindon. The organization focuses on excellence in education, teacher training, and community engagement. The website reflects a professional and comprehensive digital presence with detailed information about schools, leadership, and services. The trust maintains active social media profiles and provides clear contact details, enhancing transparency and accessibility. Technically, the website uses a modern tech stack including jQuery, Google Tag Manager, Google Maps API, and a specialized school website platform by Cleverbox. It is mobile optimized and includes accessibility features, though some improvements could be made. Performance is moderate with good SEO and structured data implementation. Security posture is solid with HTTPS enforced and cookie consent implemented. However, explicit security headers and incident response information are absent, representing areas for improvement. The lack of WHOIS data limits domain registration analysis, but the website's professionalism and trust signals mitigate concerns. Overall, the site is a credible, secure, and user-friendly platform for the educational trust, supporting its mission and stakeholder engagement effectively.

70
68
2
98
62
80
100
educationmulti-academytrustschoolsteachertrainingoxfordshire+1 more
jQuery 2.1.3Google Tag ManagerGoogle TranslateGoogle Maps API+4
2026-07-02T07:25:36.253Z
rjca.co.uk favicon

Richardson Jones Chartered Accountants

rjca.co.uk

50
FinanceUnited KingdomsmallMEDIUM

Richardson Jones Chartered Accountants is a well-established independent accounting firm based in Marlow, UK, with a history dating back to 1987. The company offers a comprehensive range of financial services including taxation, auditing, business consultancy, payroll, and HR services, catering to a diverse client base from multinational corporations to individual taxpayers. The firm holds ICAEW accreditation, reinforcing its professional credibility and commitment to quality service. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site demonstrates good mobile optimization, accessibility, and performance, hosted by GoDaddy. The presence of cookie consent mechanisms and GDPR-compliant privacy policies indicates a mature approach to privacy and regulatory compliance. From a security perspective, the site uses HTTPS and employs WordFence security plugin implied by cookies, but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious activities were detected in the content or scripts. Overall, the security posture is solid but could be improved with additional headers and transparency. The website is professional, trustworthy, and safe for general audiences, with no adult or questionable content. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and maintaining regular audits of third-party components.

47
75
65
20
25
80
2
accountingcharteredaccountantstaxservicesbusinessconsultancyfinance+2 more
WordPressYoast SEO pluginjQueryGoogle Analytics+2
2026-07-02T07:23:42.300Z
T

The Marsh Agency

marsh-agency.co.uk

47
MediaUnited KingdomsmallHIGH

The Marsh Agency is a UK-based literary agency established in 1997, offering international representation services to writers, literary agents, and publishing companies. The website reflects a professional and consistent brand presence targeting literary professionals and publishing industry stakeholders. The business model centers on representation and rights management, positioning the agency as an established player in the media sector with a small company size. Technically, the website is built on WordPress with Bootstrap and jQuery frameworks, hosted by Zen Internet Limited. It employs Google Analytics and Tag Manager for user tracking and marketing insights. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices appear adequate with proper meta tags and structured navigation. From a security perspective, the site uses HTTPS with good SSL configuration but lacks explicit security headers such as CSP or HSTS. Forms include basic anti-spam measures but no visible cookie consent or privacy compliance mechanisms beyond a privacy policy page. No incident response or security policy information is published, indicating room for improvement in security transparency and GDPR compliance. Overall, the website is trustworthy and professionally maintained, with a solid business credibility score. However, enhancements in privacy compliance, security headers, and incident response disclosures would strengthen the security posture and regulatory adherence.

70
20
80
57
53
15
2
literaryagencypublishingwritersrepresentationinternationalrepresentationmedia
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+2
2026-07-02T07:21:38.943Z
kdmevents.co.uk favicon

KDM Events Ltd

kdmevents.co.uk

59
OtherUnited KingdommediumMEDIUM

KDM Events Ltd is a UK-based corporate events management company specializing in team building, conferences, and corporate event services. The company positions itself as an award-winning provider delivering services across the UK, targeting corporate clients seeking professional event planning and management. Their key offerings include team building activities, conference management, audio visual services, content and design, audience engagement, and awards ceremonies. The website reflects a medium-sized business with a professional and consistent brand presence. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Analytics, Google Tag Manager, Google reCAPTCHA, New Relic monitoring, and CookieYes for consent management. The site is mobile optimized and demonstrates good SEO practices with structured data and meta tags. Performance is moderate with room for improvement in accessibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to mitigate spam, and implements cookie consent mechanisms. However, it lacks visible security headers and does not publish a privacy policy or terms of service within the analyzed content. The WHOIS data is unavailable or invalid, raising concerns about domain registration legitimacy, although the website content itself appears professional and trustworthy. Overall, the website presents a solid business and technical foundation but should address privacy policy publication, improve security headers, and clarify domain registration details to enhance trust and compliance.

37
100
70
60
20
17
95
corporateeventsteambuildingconferencemanagementukbusinesseventplanning
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-02T07:21:22.771Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
connect2t.co.uk favicon

Connect 2 Technology

connect2t.co.uk

67
ManufacturingUnited KingdommediumMEDIUM

Connect 2 Technology is a well-established UK-based contract electronics manufacturer specializing in cable assemblies, wiring harnesses, electronic box build, and related interconnection solutions. With over 30 years of experience and part of the Cleveland Technologies Group, the company serves OEMs and engineering teams requiring reliable, custom manufacturing support from prototype to volume production. Their market position is strengthened by certifications such as ISO 9001:2015 and IPC A-620, and a clear focus on quality and UK manufacturing standards. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Tag Manager and Mux video streaming. The site demonstrates good performance, mobile optimization, and accessibility, with comprehensive SEO and metadata implementation. Privacy compliance is well addressed with a cookie consent banner and Google Consent Mode integration. From a security perspective, the site enforces HTTPS and employs standard best practices, though explicit security headers could be enhanced. No vulnerabilities or exposed sensitive data were detected. The WHOIS data confirms a long-standing domain registration consistent with the business history, enhancing trustworthiness. Overall, the website presents a professional, trustworthy, and compliant digital presence for a medium-sized manufacturing business. Strategic recommendations include improving security header implementation, publishing a formal security policy and incident response contacts, and considering a vulnerability disclosure policy to further enhance security posture and customer trust.

80
70
100
39
95
45
17
manufacturingcableassemblieselectronicsukcontractmanufacturing+2 more
HubSpot CMSGoogle Tag ManagerSlick CarouselMux Video Streaming+1

Partner Domains:

ctecgroup.co.uk
parent
pcb.co.uk
sister
2026-07-02T07:19:46.147Z
A

AVS Fencing & Landscaping Supplies Ltd

avsfencing.co.uk

70
RetailUnited KingdommediumMEDIUM

AVS Fencing & Landscaping Supplies Ltd is a well-established UK-based supplier specializing in fencing, landscaping, and outdoor living materials. With over 25 years of experience, the company serves both DIY enthusiasts and trade customers primarily in the South East of England. The website reflects a professional retail and trade supplier business model with a clear focus on quality products and customer service. The company maintains an active online presence with integrated social media channels and customer review platforms such as Trustpilot. Technically, the website is built on the Magento 2 e-commerce platform, leveraging modern JavaScript libraries such as RequireJS and jQuery. It incorporates multiple third-party analytics and marketing tools including Google Analytics, Facebook Pixel, Bing Ads, and New Relic for performance monitoring. The site is mobile-optimized and demonstrates good SEO practices with proper meta tags and structured data. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms. However, some standard security headers like Content-Security-Policy and X-Frame-Options are not explicitly detected, suggesting an opportunity for improvement. No critical vulnerabilities or exposed sensitive data were found. Privacy and cookie policies are present and include consent mechanisms, indicating basic GDPR compliance. Overall, the website presents a trustworthy and professional front for AVS Fencing & Landscaping. The lack of WHOIS data due to domain registration issues is a concern but does not detract from the legitimacy of the business as evidenced by the detailed contact information and business presence. Strategic recommendations include enhancing security headers, improving incident response visibility, and continuing to monitor third-party scripts for vulnerabilities.

65
69
100
75
70
88
17
e-commercefencinglandscapingretailmagento+1 more
Magento 2RequireJSjQueryGoogle Tag Manager+5
2026-07-02T07:19:35.383Z