Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 24 of 656|Showing 1151-1200 of 32764
T

Terrenus Land & Water Ltd

terrenus.co.uk

46
Real EstateUnited KingdomsmallHIGH

Terrenus Land & Water Ltd is a small, specialized consultancy focused on land development risk reduction and cost management primarily in Scotland and the UK. The company positions itself as an approachable and expert partner for land developers, emphasizing timely and budget-conscious solutions. The website reflects this professional positioning with clear business descriptions, contact information, and relevant policy documents. Technically, the website employs modern web technologies including HTTPS, Google Analytics, Google Tag Manager, and reCAPTCHA, indicating a moderate level of digital maturity. However, the absence of explicit privacy and terms of service pages suggests room for improvement in compliance and transparency. Security posture is generally good with HTTPS and reCAPTCHA in place, but lack of visible security headers and incident response contacts are notable gaps. The WHOIS data for the domain 'www.terrenus.co.uk' is unavailable due to a domain registration error, which raises concerns about domain legitimacy, though the website content itself appears credible and professional. Overall, the site is safe, well-structured, and trustworthy from a content perspective but would benefit from enhanced compliance documentation and security hardening.

69
60
70
20
35
35
2
consultancylanddevelopmentukscotlandenvironment+1 more
Google AnalyticsGoogle Tag ManagerreCAPTCHAMooTools JavaScript library+2
2026-07-03T07:21:13.124Z
countrycornerscotland.co.uk favicon

Crop Services Scotland Ltd

countrycornerscotland.co.uk

46
RetailUnited KingdomsmallHIGH

Country Corner Scotland is a family-owned retail business operating since 1989 with physical stores in Kelso and Fife, UK. The company specializes in animal care products, equestrian supplies, clothing, and pet accessories, targeting local customers in these regions. Their business model focuses on providing quality products with competitive pricing and excellent customer service. The website serves as an informational and promotional platform showcasing their product categories, store locations, and offers. Technically, the website is built on Drupal 7 with common web technologies such as jQuery and Slick Slider. It employs HTTPS with good SSL configuration and uses Google Analytics with IP anonymization for user tracking. However, the CMS version is outdated, which may pose security risks if not properly maintained. The site is moderately optimized for performance and mobile devices, with basic accessibility and SEO features. From a security perspective, the site uses HTTPS but lacks important security headers and a cookie consent mechanism, which impacts privacy compliance. No explicit security policies or incident response contacts are provided, and there is no vulnerability disclosure program. The WHOIS data for the queried domain is unavailable and indicates an invalid domain name, suggesting a discrepancy between the domain used and the registered domain, which lowers trust from a domain registration standpoint. Overall, the website is professional and trustworthy in content and business representation but requires improvements in security best practices, privacy compliance, and domain registration clarity to enhance its risk posture and user trust.

50
20
57
70
53
40
2
animalcareretailclothingequestrianpetsupplies+3 more
Drupal 7jQuerySlick SliderGoogle Analytics
2026-07-03T07:20:05.771Z
T

The Travel Company Edinburgh

ttce.com

55
HospitalityUnited KingdommediumMEDIUM

The Travel Company Edinburgh is a well-established independent travel agency operating since 1991, specializing in business travel, MICE, holidays, and travel planning services primarily in Scotland and the UK. The company positions itself as a comprehensive travel management and destination management provider with strong industry memberships such as ABTA, IATA, and ATOL, enhancing its credibility and trustworthiness. The website reflects a professional and consistent brand image with good content quality and clear navigation tailored to both corporate and leisure travelers. Technically, the site is built on the Weebly/EditMySite platform, integrating modern analytics and payment technologies, though some legacy components like an outdated jQuery version are present. Security posture is solid with HTTPS and payment integration but lacks some advanced security headers and explicit cookie consent mechanisms. The absence of WHOIS data for the domain is a notable anomaly that slightly reduces trust but does not overshadow the overall legitimacy indicated by the website content and certifications. Strategic recommendations include improving privacy compliance, updating technical components, and publishing security policies to enhance trust and compliance.

37
75
75
100
2
53
20
travelbusinesstravelcorporatetravelholidayshoneymoons+4 more
Google Tag ManagerGoogle AnalyticsStripe payment integrationjQuery 1.8.3+1

Partner Domains:

www.ttceholidays.com
partner
www.in2scotland.com
partner

+1 more partners

2026-07-03T07:19:43.334Z
bpce.com favicon

Bridgers & Paxton Consulting Engineers, Inc.

bpce.com

55
EnergyUnited StatesmediumMEDIUM

Bridgers & Paxton Consulting Engineers, Inc. is a well-established engineering consulting firm specializing in mechanical, electrical, plumbing, technology, and energy engineering services primarily for government and commercial projects. With a history dating back to 1951, the company emphasizes sustainable design and innovative engineering solutions, positioning itself as a trusted partner in the energy and government sectors. Their website reflects a professional and consistent brand image, targeting government agencies and commercial clients seeking advanced engineering expertise. Technically, the website is built on WordPress using the Cornerstone theme framework, incorporating modern web technologies such as jQuery, Google Analytics, and Typekit fonts. The site demonstrates good mobile optimization and SEO practices, though performance is moderate. Security-wise, the site uses HTTPS but lacks visible security headers and explicit privacy or cookie policies, indicating room for improvement in compliance and security posture. The security posture is moderate with no critical vulnerabilities detected in the visible content, but the absence of WHOIS data for the domain www.bpce.com raises concerns about domain registration legitimacy. The site does not display privacy or cookie policies, nor incident response or vulnerability disclosure information, which are important for compliance and trust. Overall, Bridgers & Paxton presents a credible and professional online presence with strong business credibility but should address privacy, security headers, and domain registration transparency to enhance trust and compliance.

32
75
60
100
15
35
47
engineeringmepsustainabilitygovernmentconsulting
WordPressjQueryGoogle AnalyticsTypekit Fonts+1
2026-07-03T07:17:17.531Z
ruralretreats.co.uk favicon

Rural Retreats

ruralretreats.co.uk

70
HospitalityUnited KingdommediumMEDIUM

Rural Retreats is a UK-based holiday cottage rental platform offering over 920 self-catering luxury cottages across the United Kingdom. The company targets families and couples seeking idyllic holiday accommodations, positioning itself as a reputable and established player in the UK hospitality sector. The website provides comprehensive information about its offerings, supported by customer reviews and a professional online presence. Technically, the website employs a modern technology stack including jQuery, Google Tag Manager, Cookiebot for consent management, and New Relic for performance monitoring. It integrates multiple third-party analytics and marketing tools, ensuring good digital maturity and performance. The site is mobile-optimized and uses HTTPS with appropriate security headers, reflecting a solid technical foundation. From a security perspective, the website demonstrates good practices such as enforcing HTTPS, implementing cookie consent mechanisms, and using reCAPTCHA. However, it lacks publicly available security policies and incident response information, which could be improved to enhance transparency and trust. The absence of WHOIS data due to domain naming rules error is a notable anomaly but does not detract significantly from the overall legitimacy based on website content. Overall, Rural Retreats presents a trustworthy and professional online platform with moderate to strong security and privacy compliance. Strategic improvements in publishing security policies and incident response details, along with resolving domain registration transparency, would further strengthen its risk posture and stakeholder confidence.

75
100
72
65
17
88
60
holidaycottagesuktravelself-cateringvacationrentalsfamilyholidays+3 more
jQuery 3.6.0jQuery UI 1.13.3Google Tag ManagerGoogle Analytics+4
2026-07-03T07:16:36.994Z
fletchersengineering.co.uk favicon

Fletchers Engineering

fletchersengineering.co.uk

47
ManufacturingUnited KingdommediumHIGH

Fletchers Engineering is a well-established UK-based engineering company specializing in HVAC fabrication, installation, and maintenance services. With over 30 years of industry experience, the company serves a diverse range of sectors including energy, manufacturing, hospitality, and government. Their website reflects a professional and comprehensive presentation of their services, supported by multiple industry accreditations and certifications, positioning them as a reputable player in their market segment. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Slick Slider, and integrates key tools like Google Analytics, Hotjar, and Google reCAPTCHA for analytics and security. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms, indicating a mature digital presence. However, some improvements in accessibility and security headers could enhance the technical posture. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security policies and incident response information. The WHOIS data is unavailable due to a query on the subdomain rather than the registered domain, which slightly reduces trustworthiness from a domain registration standpoint. Overall, the security posture is good but could benefit from additional transparency and technical hardening. The overall risk assessment is moderate-low, with the main concerns being the incomplete WHOIS data and absence of published security policies. Strategic recommendations include verifying domain registration details, implementing security.txt and incident response pages, and enhancing HTTP security headers to improve trust and compliance.

20
80
25
2
60
40
67
hvacengineeringfabricationmaintenanceuk+4 more
WordPressjQuerySlick SliderGoogle reCAPTCHA+4
2026-07-03T07:14:36.022Z
transdrive.co.uk favicon

Transdrive Engineering Services Ltd

transdrive.co.uk

48
ManufacturingUnited KingdommediumHIGH

Transdrive Engineering Services Ltd operates as a leading European distributor and stockist of power transmission products, including industrial motors, gearboxes, and drives. The company targets industrial and manufacturing sectors, offering over 6000 product lines and technical support services. Their website reflects a professional business presence with clear contact information and product offerings, positioning them as a key player in their niche market. Technically, the website employs a modern tech stack including Bootstrap, jQuery, Umbraco CMS, and integrates Google Analytics and live chat support. The site is mobile-optimized with good navigation and content quality, though some accessibility features are basic. Performance is moderate, and SEO practices are adequately implemented. From a security perspective, the site uses HTTPS and cookie consent mechanisms but lacks visible security headers and explicit privacy or security policies. The WHOIS data is unavailable due to domain registration errors, raising concerns about domain legitimacy. No critical vulnerabilities were detected in the content, but improvements in security headers and privacy compliance are recommended. Overall, the website presents a moderate risk profile with good business credibility but requires enhancements in security posture and compliance documentation to strengthen trust and reduce potential risks.

20
65
75
57
30
65
2
industrialmotorsgearboxespowertransmissiondistributor+1 more
jQueryBootstrapGoogle AnalyticsModernizr+2
2026-07-03T07:14:13.356Z
G

GDS Instruments (A division of Global Digital Systems Ltd)

gdsinstruments.com

51
ManufacturingUnited KingdommediumMEDIUM

GDS Instruments, a division of Global Digital Systems Ltd, is a UK-based manufacturer specializing in soil and rock testing apparatus and related software for geotechnical and earthquake engineering applications. The company targets professionals and institutions in geotechnical engineering, offering a broad portfolio of testing equipment and technical support services. Their market position is that of a specialist manufacturer with a strong focus on quality and technical expertise. Technically, the website is built on ASP.NET WebForms with Bootstrap for responsive design, integrating modern analytics tools such as Google Analytics and LinkedIn Insight. The site is mobile-optimized and presents a professional user experience, although some accessibility features could be improved. The performance is moderate, with no critical technical issues detected. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA for form protection, but lacks several security headers and explicit security or incident response policies. The absence of WHOIS domain registration data is a notable concern, impacting trust and legitimacy assessments. Privacy and cookie policies are present, but the lack of a cookie consent mechanism reduces GDPR compliance confidence. Overall, the website is professional and trustworthy in content and presentation but would benefit from improved transparency in domain registration, enhanced security headers, and stronger privacy compliance mechanisms to reduce risk and increase stakeholder confidence.

57
70
40
80
2
15
68
soiltestingrocktestinggeotechnicalengineeringmaterialtestingearthquakeengineering+2 more
jQueryGoogle AnalyticsGoogle Tag ManagerreCAPTCHA+2
2026-07-03T07:14:07.776Z
texasmutual.com favicon

Texas Mutual Insurance Company

texasmutual.com

69
GovernmentUnited StateslargeMEDIUM

Texas Mutual Insurance Company operates as the leading workers' compensation insurance provider in Texas, serving over 80,000 businesses and 1.5 million workers. The company emphasizes strong community ties, safety resources, and policyholder dividends, positioning itself as a trusted partner for Texas employers. The website reflects a mature digital presence with comprehensive content tailored to multiple user groups including employers, agents, healthcare providers, and injured workers. Technically, the site leverages modern frameworks such as Bootstrap and Webflow CMS, integrates multiple marketing and analytics tools, and maintains good mobile optimization and accessibility standards. Security posture is strong with HTTPS enforced and secure login portals, though explicit security headers and vulnerability disclosure policies are absent. Privacy compliance is partial, with a clear privacy policy but lacking cookie consent mechanisms. WHOIS data is unavailable, which is unusual for a major insurer, but the website's branding and external references strongly support legitimacy. Overall, the site demonstrates a professional, secure, and user-friendly platform with room for improvement in privacy and security transparency.

77
85
80
100
60
65
2
workerscompensationinsurancetexasemployerssafety+3 more
jQuery 3.4.1Bootstrap 4.3.1Google Fonts (Montserrat, IvyPresto)FontAwesome 6.5.2+9

Partner Domains:

app.texasmutual.com
service
secure.texasmutual.com
service

+2 more partners

2026-07-03T07:12:04.096Z
reviso.com favicon

Reviso Cloud Accounting Limited

reviso.com

73
TechnologyUnited KingdommediumMEDIUM

Reviso Cloud Accounting Limited operates a professional website offering cloud-based bookkeeping and accounting software tailored for small and medium-sized enterprises (SMEs), accounting practices, and self-employed professionals. The company provides a comprehensive suite of services including invoicing, bank reconciliation, asset management, and project accounting, positioning itself as a complete cloud accounting solution in the UK market. The website is well-structured, visually appealing, and optimized for user experience with clear navigation and mobile responsiveness. Technically, the website employs modern web technologies such as Google Tag Manager, Google Analytics, jQuery, and various UI libraries to enhance functionality and tracking. The site enforces HTTPS with strong SSL configuration and implements security headers, reflecting a good security posture. Privacy compliance is evident through detailed privacy and cookie policies, along with a consent mechanism, aligning with GDPR requirements. However, the WHOIS data for the domain is missing or inaccessible, which raises questions about domain registration transparency. No explicit security policy or incident response information is published, and there is no vulnerability disclosure or security.txt file available. These gaps suggest areas for improvement in security communication and transparency. Overall, the website presents a trustworthy and professional front for its cloud accounting services, but the domain registration opacity and lack of published security policies warrant cautious monitoring and potential enhancements in security governance and disclosure.

72
65
100
75
70
100
17
cloudaccountingbookkeepingsoftwaresmeaccountinginvoicingsoftwarefinancialreports+3 more
Google Tag ManagerGoogle AnalyticsjQuerySelect2+4
2026-07-03T07:10:00.337Z
K

Kingston Cleaning Services

kingstoncleaningservices.co.uk

51
OtherUnited KingdommediumMEDIUM

Kingston Cleaning Services (KCS) is a UK-based commercial and industrial cleaning company specializing in a wide range of interior and exterior cleaning services across Yorkshire and the UK. The company serves diverse sectors including commercial, industrial, and domestic clients, offering services such as building fabric cleaning, window cleaning, pressure washing, and high-level cleaning. KCS emphasizes health and safety, with trained teams and strong site compliance, positioning itself as a reliable and reputable cleaning partner with over 70 years of combined experience in the industry. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site is mobile-optimized with good navigation and content structure, though some security headers could be improved. The website uses HTTPS and reCAPTCHA for form security, reflecting a moderate to good security posture. Security-wise, the site demonstrates good practices including HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. However, it lacks explicit incident response contacts and a vulnerability disclosure policy, which are recommended for enhanced security maturity. Privacy and cookie policies are present and appear GDPR compliant, supporting privacy compliance. Overall, the website is professional, trustworthy, and well-maintained, though the WHOIS data is unavailable due to domain registration lookup issues. This does not detract from the legitimacy of the business, but it is recommended to verify domain registration details through alternative means. Strategic improvements in security headers and incident response transparency would further strengthen the security posture.

40
70
60
57
17
15
68
cleaningcommercialcleaningindustrialcleaningwindowcleaningpressurewashing+3 more
WordPressYoast SEOGoogle Tag ManagerGoogle Analytics+2
2026-07-03T07:09:43.497Z
gfelectrical.co.uk favicon

GF Electrical

gfelectrical.co.uk

50
EnergyUnited KingdommediumMEDIUM

GF Electrical is a well-established electrical contracting company based in Dorset, UK, with a domain age dating back to 2004. The company offers a broad range of electrical services including commercial, industrial, residential electrical work, fire alarms, emergency lighting, and EV charging solutions. Their market position is strong within the South of England, supported by long-term client relationships and multiple industry accreditations such as ECA, BAFE, NICEIC, and SafeContractor. The website reflects a professional business model focused on service delivery to domestic, commercial, and industrial sectors. Technically, the website is built on WordPress using popular plugins and tools such as WPBakery Page Builder, Gravity Forms, and integrates analytics and marketing tools including Google Analytics, Google Tag Manager, Facebook Pixel, Smartlook, and Tawk.to live chat. The site is mobile optimized with good SEO practices and moderate performance. Hosting and domain registration are managed via Cloudflare, providing a reliable infrastructure. From a security perspective, the site uses HTTPS and some security best practices but lacks explicit security headers and a published security or incident response policy. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is partial; a cookie policy with consent mechanism is present, but no privacy policy page was found, representing a compliance gap. Contact information is clearly provided, enhancing business credibility. Overall, GF Electrical's website presents a trustworthy and professional digital presence with room for improvement in privacy policy publication and security header implementation. The risk level is low, but addressing compliance gaps and enhancing security posture would strengthen trust and regulatory adherence.

100
55
-
65
17
15
65
electricalcontractorsfirealarmscommercialelectricalindustrialelectricalresidentialelectrical+5 more
WordPressWPBakery Page BuilderGravity FormsjQuery+5
2026-07-03T07:09:04.324Z
crowncastle.com favicon

Crown Castle

crowncastle.com

61
TelecommunicationsUnited StatesenterpriseMEDIUM

Crown Castle is a leading telecommunications infrastructure provider in the United States, specializing in shared communications infrastructure such as cell towers, small cells, and fiber networks. The company positions itself as the nation's largest provider in this sector, targeting wireless carriers, public sector entities, industrial enterprises, property owners, and investors. Their business model focuses on leasing and managing infrastructure assets to enable wireless connectivity nationwide. The website reflects a mature enterprise with comprehensive service offerings and a strong market presence. Technically, the website employs a modern technology stack including Vue.js, jQuery, and integrates multiple marketing and analytics platforms such as Google Analytics, Microsoft Clarity, Hotjar, and Marketo. The site is mobile-optimized, accessible, and SEO-friendly, with fast to moderate performance. The use of reputable third-party services and secure form handling indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses secure form submissions. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not evident in the HTML source, suggesting room for improvement. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The WHOIS data is unavailable, likely due to privacy protection, but the website's professionalism and consistency support its legitimacy. Overall, Crown Castle's website demonstrates a strong business and technical foundation with good security practices. Recommendations include enhancing security headers, publishing an incident response policy, and adding a vulnerability disclosure program to further strengthen trust and security posture.

80
100
85
47
17
15
58
telecommunicationsinfrastructurecelltowerssmallcellsfiber+3 more
jQuery 3.6.3Vue.js 2Marketo FormsGoogle Tag Manager+10

Partner Domains:

investor.crowncastle.com
subsidiary
2026-07-03T07:08:36.245Z
susmangodfrey.com favicon

Susman Godfrey L.L.P.

susmangodfrey.com

74
OtherUnited StateslargeMEDIUM

Susman Godfrey L.L.P. is a premier litigation law firm specializing in complex and high-stakes legal cases. The firm is highly ranked nationally, holding the Vault #1 litigation boutique position in the US for over a decade. Their services focus on trial law, class actions, privacy litigation, business disputes, arbitration, and pro bono work, targeting corporations, plaintiffs, and defendants involved in litigation. The website reflects a mature and professional legal services business with a strong market presence. Technically, the website is built on WordPress with modern technologies such as jQuery, Algolia Search for enhanced search functionality, and Google Analytics for visitor insights. The site is well optimized for SEO, mobile responsive, and fast loading, indicating a high level of digital maturity. Privacy compliance is robust with clear privacy and cookie policies and a consent mechanism. From a security perspective, the site uses HTTPS with a valid SSL certificate and employs cookie consent blocking for analytics scripts. However, no explicit security headers were detected in the HTML source, and no incident response or security policy pages were found. The WHOIS data is unavailable, which slightly reduces transparency but is common for professional firms protecting registrant privacy. Overall, the security posture is good but could be improved with additional headers and published security policies. The overall risk assessment is low, with the main recommendation being to enhance security headers and incident response visibility. The website is trustworthy, professional, and compliant with privacy regulations, making it suitable for its target audience and business model.

100
85
80
54
95
17
80
lawfirmlitigationlegalservicesprivacycookieconsent+3 more
jQueryAlgolia SearchGoogle AnalyticsYoast SEO+2
2026-07-03T07:08:25.028Z
commercial-properties-scotland.co.uk favicon

James Keiller Property Holdings Ltd

commercial-properties-scotland.co.uk

58
Real EstateUnited KingdommediumMEDIUM

James Keiller Property Holdings Ltd is a privately owned property development, investment, and management company based in Dundee, Scotland, established in 1981. The company focuses on residential and commercial property projects across Scotland, with a strong presence in Tayside and the central belt. Their services include land sourcing, planning, project management, construction, acquisition, and disposal, targeting landowners, financial institutions, and local authorities. The website presents a professional image with clear contact details and partner affiliations but lacks key compliance documents such as privacy and cookie policies. Technically, the site is built on WordPress with Elementor and uses Google Analytics and Tag Manager for tracking. Security posture is adequate with HTTPS enabled and secure forms, but missing security headers and absence of incident response or security policies reduce maturity. The WHOIS data is missing or unavailable, which raises concerns about domain legitimacy despite the professional website content. Overall, the site is functional and business-appropriate but would benefit from improved transparency and security practices.

72
65
100
70
35
2
45
propertydevelopmentrealestateinvestmentcommercialpropertyresidentialproperty+2 more
WordPressElementorjQueryGoogle Tag Manager+1

Partner Domains:

zoopla.co.uk
partner
lettingweb.com
partner
2026-07-03T07:07:15.142Z
W

Wrigleys Solicitors LLP

wrigleys.co.uk

64
OtherUnited KingdommediumMEDIUM

Wrigleys Solicitors LLP is a well-established specialist law firm operating primarily in the UK with offices in Leeds, Sheffield, and Newcastle. The firm focuses on advising private clients, charities, trustees, and businesses in sectors such as trusts, tax, pensions, property, agriculture, education, and employment law. Their market position is reinforced by multiple industry certifications and recognitions, including Legal 500 and Chambers rankings. The website reflects a professional and comprehensive digital presence with clear navigation and rich content tailored to their target audience. Technically, the website employs modern web technologies including jQuery, Bootstrap, Google Analytics, Google Tag Manager, and Google reCAPTCHA for security on forms. The site is mobile-optimized and demonstrates good SEO practices. While no explicit CMS or hosting provider was identified, the infrastructure appears stable and performant. From a security perspective, the site uses HTTPS with a strong SSL configuration and implements cookie consent and CAPTCHA mechanisms to protect user data and prevent abuse. However, security headers are not explicitly detected and no public security or incident response policies are found, indicating room for improvement in transparency and defense-in-depth. Overall, the website is trustworthy and professional with no signs of malicious activity or content safety concerns. The lack of WHOIS data due to domain query failure limits full domain legitimacy verification, but the business credentials and content strongly support authenticity. Strategic recommendations include enhancing security headers, publishing incident response information, and continuous monitoring of third-party scripts.

57
85
70
100
30
68
17
lawlegalsolicitorstrustspensions+4 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA+5
2026-07-03T07:06:52.756Z
E

Eagle Overseas

eagleoverseas.com

60
TransportationUnited KingdomsmallMEDIUM

Eagle Overseas is a UK-based logistics service provider specializing in transport, warehousing, and customs clearance. The company has a well-established online presence with a domain registered since 2000, indicating long-term business operations. The website is built on WordPress using the Divi theme and incorporates standard plugins such as Gravity Forms and Google reCAPTCHA to facilitate user interaction and spam protection. Google Analytics is employed for visitor tracking, reflecting a moderate level of digital maturity. From a security perspective, the website benefits from HTTPS encryption and domain transfer protection, but lacks advanced DNS security measures such as DNSSEC. The absence of a published privacy policy, terms of service, and vulnerability disclosure documents indicates gaps in compliance and transparency. The cookie consent mechanism is present and functional, supporting GDPR compliance to some extent. No critical security vulnerabilities or malicious content were detected during the analysis. Overall, Eagle Overseas demonstrates a moderate security posture with room for improvement in privacy compliance and security best practices. The website quality and user experience are good, supporting the company's business objectives effectively. Strategic enhancements in security headers, policy documentation, and DNS security would strengthen trust and regulatory adherence.

70
70
32
100
25
95
17
transportwarehousingcustomslogisticswordpress+3 more
WordPressDivi ThemejQueryGravity Forms+3
2026-07-03T07:06:30.333Z
coupesandconvertibles.co.uk favicon

Coupes and Convertibles Ltd

coupesandconvertibles.co.uk

56
TransportationUnited KingdomsmallMEDIUM

Coupes and Convertibles Ltd operates a specialized vehicle sales business focused on campervans and leisure vehicles in the Berkshire region of the United Kingdom. The company offers a range of new, used, and pre-registered vans, including hand-built campervan conversions with sustainable off-grid electrical packages. Their market position is that of a niche local dealer with a strong emphasis on multifunctional campervans suitable for both leisure and mobile office use. The website reflects a small-sized business with a professional online presence, FCA regulation, and customer trust signals such as testimonials and clear contact information. Technically, the website is built on WordPress with modern web technologies including Yoast SEO, Google Tag Manager, Google Analytics, and Typekit fonts. The site is hosted with CDN support (Cloudfront) and uses HTTPS with good SSL configuration. Performance and mobile optimization are good, though accessibility features are basic. SEO is well implemented with proper meta tags and structured data. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism compliant with GDPR. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not detected, and no security.txt or incident response information is provided. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data query for the 'www' subdomain failed due to domain naming rules, but the main domain is active and consistent with the business claims. Overall, the website presents a trustworthy and professional business with a solid technical foundation and good privacy compliance. The main risk areas include incomplete WHOIS data, lack of explicit security headers, and absence of formal security policies or vulnerability disclosure channels. Strategic improvements in these areas would enhance the security posture and trustworthiness further.

70
100
27
60
30
80
2
campervanvehiclesaleswokinghamberkshirefinance+2 more
WordPressYoast SEOjQueryGoogle Tag Manager+3

Partner Domains:

dragon2000.co.uk
partner
2026-07-03T07:00:37.126Z
C

CloudNine Creative Interiors

descabusinessfurniture.co.uk

59
Real EstateUnited KingdomsmallMEDIUM

CloudNine Creative Interiors is a UK-based bespoke interior design and furniture manufacturing company specializing in high-quality office and residential furniture. The company emphasizes craftsmanship with over 70 years of combined experience and holds accreditations for specialized materials such as Corian and Krion. Their market position is that of a niche provider catering to both corporate and private clients, offering full design consultancy and installation services. The website reflects a professional and consistent brand image with clear contact details and customer testimonials, enhancing trustworthiness. Technically, the website is built on the itseeze CMS platform and employs modern web technologies including Google Analytics and Tag Manager for minimal user tracking. The site is mobile-optimized with responsive design scripts and good SEO practices. Performance is moderate, and accessibility is basic but functional. Security posture is solid with HTTPS enforced and cookie consent implemented, though security headers and advanced policies are lacking. The security evaluation reveals no critical vulnerabilities or exposed sensitive data. However, the absence of security headers and a formal incident response or vulnerability disclosure policy are areas for improvement. Privacy compliance is adequate with clear privacy and cookie policies and GDPR consent mechanisms in place. WHOIS data could not be extracted due to a query error on the 'www' subdomain, but the domain appears legitimate and consistent with the business branding. Overall, the website presents a low-risk profile with good business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing a security policy, and improving accessibility to further strengthen the security posture and compliance framework.

60
70
37
100
60
2
68
interiordesignbespokefurnitureofficefurniturecommercialinteriorsresidentialinteriors+2 more
Google AnalyticsGoogle Tag ManagerCustom JavaScriptResponsive design scripts
2026-07-02T07:27:08.145Z
hillierjewellers.co.uk favicon

Hillier Jewellers

hillierjewellers.co.uk

67
RetailUnited KingdommediumMEDIUM

Hillier Jewellers is a UK-based online retailer specializing in fashion jewellery and giftware, offering quality products at competitive prices with promotional incentives such as discounts for first orders. The company targets a broad general audience interested in jewellery and watches, operating primarily through an e-commerce platform. The website demonstrates a solid digital presence with integrated customer reviews and active social media channels, supporting its market position as a reputable retailer in the UK jewellery sector. Technically, the website employs modern web technologies including JavaScript libraries, Google Analytics, and Facebook Pixel for marketing and analytics purposes. The site is mobile-optimized and exhibits good SEO and accessibility practices, although some accessibility features could be enhanced. Security-wise, the site enforces HTTPS, includes standard security headers, and avoids exposing sensitive data, reflecting a good security posture. However, the absence of a public security policy and incident response information suggests room for improvement in transparency and preparedness. The WHOIS data retrieval failed due to domain naming issues, which limits full verification of domain legitimacy, but the active and professional website presence supports its credibility. Overall, Hillier Jewellers presents a trustworthy and well-maintained online retail platform with moderate technical maturity and a good security baseline.

74
100
60
65
73
70
17
jewellerye-commercefashionretailuk
JavaScriptGoogle AnalyticsFacebook PixelGoogle Tag Manager+2
2026-07-02T07:26:13.874Z
redearthstudio.com favicon

Red Earth Studio Ltd.

redearthstudio.com

55
MediaUnited KingdomsmallMEDIUM

Red Earth Studio Ltd. is a London-based award-winning film and video production company specializing in branded content and documentaries since 2003. The company targets brands and businesses seeking impactful storytelling through film. Their market position is established and reputable within the media production sector, offering full-service production capabilities. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress 6.9.4 with a modern tech stack including jQuery, Google Analytics, and Mailchimp integrations. The site is mobile-optimized and performs moderately well, though accessibility features are basic. SEO is enhanced by Yoast SEO plugin usage. However, no hosting provider or CDN details were identified. Security posture is adequate with HTTPS enabled and no visible sensitive data exposure. However, the absence of security headers and privacy/cookie policies indicates room for improvement in compliance and security best practices. The WHOIS data is missing, which raises concerns about domain registration transparency, although the website content and business information appear legitimate. Overall, the website is professional and trustworthy but would benefit from enhanced privacy compliance, security headers, and WHOIS transparency to improve trust and security posture.

25
35
2
70
52
85
100
filmvideoproductionmedialondonbrandedcontent+1 more
WordPress 6.9.4jQuery 3.7.1Google AnalyticsYoast SEO plugin+5
2026-07-02T07:25:41.652Z
rjca.co.uk favicon

Richardson Jones Chartered Accountants

rjca.co.uk

50
FinanceUnited KingdomsmallMEDIUM

Richardson Jones Chartered Accountants is a well-established independent accounting firm based in Marlow, UK, with a history dating back to 1987. The company offers a comprehensive range of financial services including taxation, auditing, business consultancy, payroll, and HR services, catering to a diverse client base from multinational corporations to individual taxpayers. The firm holds ICAEW accreditation, reinforcing its professional credibility and commitment to quality service. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site demonstrates good mobile optimization, accessibility, and performance, hosted by GoDaddy. The presence of cookie consent mechanisms and GDPR-compliant privacy policies indicates a mature approach to privacy and regulatory compliance. From a security perspective, the site uses HTTPS and employs WordFence security plugin implied by cookies, but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious activities were detected in the content or scripts. Overall, the security posture is solid but could be improved with additional headers and transparency. The website is professional, trustworthy, and safe for general audiences, with no adult or questionable content. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and maintaining regular audits of third-party components.

47
75
65
20
25
80
2
accountingcharteredaccountantstaxservicesbusinessconsultancyfinance+2 more
WordPressYoast SEO pluginjQueryGoogle Analytics+2
2026-07-02T07:23:42.300Z
T

The Marsh Agency

marsh-agency.co.uk

47
MediaUnited KingdomsmallHIGH

The Marsh Agency is a UK-based literary agency established in 1997, offering international representation services to writers, literary agents, and publishing companies. The website reflects a professional and consistent brand presence targeting literary professionals and publishing industry stakeholders. The business model centers on representation and rights management, positioning the agency as an established player in the media sector with a small company size. Technically, the website is built on WordPress with Bootstrap and jQuery frameworks, hosted by Zen Internet Limited. It employs Google Analytics and Tag Manager for user tracking and marketing insights. The site is moderately performant with good mobile optimization and basic accessibility features. SEO practices appear adequate with proper meta tags and structured navigation. From a security perspective, the site uses HTTPS with good SSL configuration but lacks explicit security headers such as CSP or HSTS. Forms include basic anti-spam measures but no visible cookie consent or privacy compliance mechanisms beyond a privacy policy page. No incident response or security policy information is published, indicating room for improvement in security transparency and GDPR compliance. Overall, the website is trustworthy and professionally maintained, with a solid business credibility score. However, enhancements in privacy compliance, security headers, and incident response disclosures would strengthen the security posture and regulatory adherence.

70
20
80
57
53
15
2
literaryagencypublishingwritersrepresentationinternationalrepresentationmedia
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+2
2026-07-02T07:21:38.943Z
kdmevents.co.uk favicon

KDM Events Ltd

kdmevents.co.uk

59
OtherUnited KingdommediumMEDIUM

KDM Events Ltd is a UK-based corporate events management company specializing in team building, conferences, and corporate event services. The company positions itself as an award-winning provider delivering services across the UK, targeting corporate clients seeking professional event planning and management. Their key offerings include team building activities, conference management, audio visual services, content and design, audience engagement, and awards ceremonies. The website reflects a medium-sized business with a professional and consistent brand presence. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Analytics, Google Tag Manager, Google reCAPTCHA, New Relic monitoring, and CookieYes for consent management. The site is mobile optimized and demonstrates good SEO practices with structured data and meta tags. Performance is moderate with room for improvement in accessibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to mitigate spam, and implements cookie consent mechanisms. However, it lacks visible security headers and does not publish a privacy policy or terms of service within the analyzed content. The WHOIS data is unavailable or invalid, raising concerns about domain registration legitimacy, although the website content itself appears professional and trustworthy. Overall, the website presents a solid business and technical foundation but should address privacy policy publication, improve security headers, and clarify domain registration details to enhance trust and compliance.

37
100
70
60
20
17
95
corporateeventsteambuildingconferencemanagementukbusinesseventplanning
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-02T07:21:22.771Z
vesselgallery.com favicon

Vessel Gallery

vesselgallery.com

58
OtherUnited KingdomsmallMEDIUM

Vessel Gallery is a London-based contemporary art gallery specializing in high-end art glass, ceramics, sculpture, and decorative lighting. The gallery positions itself as a UK leader in museum-quality contemporary art glass and serves collectors, interior designers, and art enthusiasts. Their business model revolves around exhibitions, sales, and commissions, supported by a professional online presence and active social media engagement. The website is powered by the MasterArt platform, indicating a specialized infrastructure for art galleries. Technically, the website employs modern web technologies including jQuery, Bootstrap 4.3.1, and Slick Carousel for UI components, alongside Google Analytics and Mailchimp for marketing and analytics. The site is mobile-optimized with good SEO practices and a cookie consent mechanism, reflecting a moderate to good digital maturity level. However, some security headers and explicit security policies are not evident, suggesting room for improvement in security hardening. From a security perspective, the site uses HTTPS and has implemented cookie consent, but lacks visible security headers and incident response information. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data for the domain is a concern and reduces trustworthiness, although the website content and business information appear legitimate and professional. Overall, the website scores well in content quality and privacy compliance but could improve in security posture and domain registration transparency. Strategic recommendations include enhancing security headers, verifying domain registration details, and adding incident response contacts to strengthen trust and compliance.

70
57
100
75
2
68
15
artglasscontemporaryartgallerysculptureceramics+4 more
jQueryBootstrap 4.3.1Slick CarouselGoogle Analytics+1
2026-07-02T07:20:42.683Z
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
A

AVS Fencing & Landscaping Supplies Ltd

avsfencing.co.uk

70
RetailUnited KingdommediumMEDIUM

AVS Fencing & Landscaping Supplies Ltd is a well-established UK-based supplier specializing in fencing, landscaping, and outdoor living materials. With over 25 years of experience, the company serves both DIY enthusiasts and trade customers primarily in the South East of England. The website reflects a professional retail and trade supplier business model with a clear focus on quality products and customer service. The company maintains an active online presence with integrated social media channels and customer review platforms such as Trustpilot. Technically, the website is built on the Magento 2 e-commerce platform, leveraging modern JavaScript libraries such as RequireJS and jQuery. It incorporates multiple third-party analytics and marketing tools including Google Analytics, Facebook Pixel, Bing Ads, and New Relic for performance monitoring. The site is mobile-optimized and demonstrates good SEO practices with proper meta tags and structured data. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms. However, some standard security headers like Content-Security-Policy and X-Frame-Options are not explicitly detected, suggesting an opportunity for improvement. No critical vulnerabilities or exposed sensitive data were found. Privacy and cookie policies are present and include consent mechanisms, indicating basic GDPR compliance. Overall, the website presents a trustworthy and professional front for AVS Fencing & Landscaping. The lack of WHOIS data due to domain registration issues is a concern but does not detract from the legitimacy of the business as evidenced by the detailed contact information and business presence. Strategic recommendations include enhancing security headers, improving incident response visibility, and continuing to monitor third-party scripts for vulnerabilities.

65
69
100
75
70
88
17
e-commercefencinglandscapingretailmagento+1 more
Magento 2RequireJSjQueryGoogle Tag Manager+5
2026-07-02T07:19:35.383Z
V

Viking Tapes

vikingtapes.co.uk

71
E-commerceUnited KingdomsmallMEDIUM

Viking Tapes operates as a UK-based e-commerce retailer specializing in adhesive tapes and related products, prominently featuring 3M branded tapes, masking tapes, eco-friendly tapes, and glue dots. The website positions itself as a market leader in the UK online tape market, targeting both business and consumer customers. The business model is focused on direct online sales through a Shopify-powered platform, leveraging over 25 years of industry experience to provide expert advice and product offerings. Technically, the website is built on Shopify, utilizing modern analytics and marketing tools such as Google Analytics, Microsoft Clarity, Sendinblue, and Brevo, indicating a mature digital infrastructure. The site is mobile-optimized with good SEO and basic accessibility features, though there is room for improvement in accessibility compliance and security header implementation. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security policies and vulnerability disclosure information. WHOIS data for the queried domain 'www.vikingtapes.co.uk' is unavailable due to invalid query format; however, the website content and technical setup suggest a legitimate business. Overall, the site is professional, trustworthy, and safe for general audiences, with moderate risk due to incomplete WHOIS transparency and missing privacy policy documentation.

100
85
44
70
75
17
100
e-commerceadhesivetapes3mtapesmaskingtapesshopify+4 more
ShopifyGoogle AnalyticsGoogle Tag ManagerSendinblue+4
2026-07-02T07:18:57.311Z
kingstonrecruitment.co.uk favicon

Kingston Recruitment Ltd

kingstonrecruitment.co.uk

46
OtherUnited KingdomsmallHIGH

Kingston Recruitment Ltd is a well-established recruitment agency based in Hull, East Yorkshire, specializing in office and commercial recruitment services including temporary, contract, and permanent placements. Founded in 1985, the company serves both candidates and clients with a strong regional presence and a reputation for quality service. The website reflects a professional business model focused on staffing solutions for a variety of sectors. Technically, the website employs a modern frontend stack including Bootstrap, jQuery, Owl Carousel, and integrates live chat via Tawk.to and analytics through Google Analytics and Tag Manager. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. Security posture is moderate; HTTPS is implied but no security headers were detected in the provided data, and no explicit security or incident response policies are published. Privacy compliance is basic with a privacy policy present but lacking cookie consent mechanisms. WHOIS data could not be retrieved due to domain naming issues, which raises concerns about domain registration consistency but does not directly impact the legitimacy of the business as presented on the site. Overall, the website is professional and trustworthy but would benefit from enhanced security and privacy practices.

70
65
20
57
15
17
53
recruitmentjobsemploymenthulleastyorkshire+3 more
jQueryBootstrapOwl CarouselPrettyPhoto+2
2026-07-02T07:18:08.585Z