Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 200 of 556|Showing 9951-10000 of 27753
ipgmediabrands.com favicon

IPG Mediabrands

ipgmediabrands.com

68
MediaN/aenterpriseMEDIUM

IPG Mediabrands is a global media and marketing agency network focused on delivering innovative advertising and media solutions to clients worldwide. The company positions itself as a forward-thinking organization that adapts to fast-moving consumer behaviors, offering award-winning agencies and services that drive growth. The website reflects a mature enterprise with a strong digital presence, including comprehensive privacy and cookie policies aligned with GDPR requirements. Technically, the site is built on WordPress with modern plugins and libraries such as Yoast SEO, Vimeo Player API, and Swiper.js, hosted likely on WPEngine, ensuring reliable performance and scalability. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, though there is room for improvement in implementing security headers and explicit incident response policies. The absence of WHOIS data is a notable gap, possibly due to privacy protection, but the overall digital footprint and branding consistency support the legitimacy of the business. Strategic recommendations include enhancing security headers, publishing security policies, and improving direct contact availability to strengthen trust and compliance.

70
95
2
70
42
80
100
mediaadvertisingmarketinggdprprivacy+3 more
WordPressYoast SEO pluginjQueryVimeo Player API+1

Partner Domains:

careers.ipgmediabrands.com
partner
apac.ipgmediabrands.com
subsidiary

+3 more partners

2025-10-13T21:13:08.847Z
npsumava.cz favicon

Národní park Šumava

npsumava.cz

57
GovernmentCzech RepublicmediumMEDIUM

Národní park Šumava operates as the official authority managing the Šumava National Park and its protected landscape area in the Czech Republic. The website serves as a comprehensive information portal for visitors, environmental researchers, and the general public interested in the park's natural heritage, events, and conservation efforts. It offers resources such as visitor centers, ecological education, maps, webcams, and an e-shop. The site is positioned as a trusted governmental and non-profit entity in the environmental conservation sector within the Czech Republic. Technically, the website is built on WordPress using modern plugins like Elementor for design, WPML for multilingual support, and performance optimizations via WP Rocket. It integrates analytics and marketing tools such as Google Analytics, Google Tag Manager, Facebook SDK, and OneSignal for push notifications. The site is mobile-optimized, accessible, and SEO-friendly, with appropriate meta tags and structured data enhancing search engine visibility. From a security perspective, the site enforces HTTPS and includes several security headers, indicating a good baseline security posture. Cookie consent mechanisms and privacy policies demonstrate GDPR compliance. However, the absence of WHOIS registration data and lack of explicit security policies or incident response contacts represent areas for improvement. No vulnerabilities or exposed sensitive data were detected in the analysis. Overall, the website presents a professional and trustworthy digital presence for the Šumava National Park authority, with recommendations to enhance transparency around security policies and domain registration details to further strengthen trust and compliance.

85
25
17
83
62
85
20
nationalparkenvironmentnatureconservationtourismgovernment+2 more
WordPressjQueryElementorGoogle Analytics+5
2025-10-13T20:08:07.558Z
svt-magazin.cz favicon

Svaz podnikatelů ve stínicí technice - SPST

svt-magazin.cz

61
OtherCzech RepublicsmallMEDIUM

The website www.svt-magazin.cz serves as a specialized industry magazine focused on shading and gate technology, operated by the Svaz podnikatelů ve stínicí technice (SPST), a professional association established in 2009. It provides news, articles, event calendars, and advertising opportunities targeted at both professionals and laypersons interested in this niche sector. The site maintains a professional and consistent brand presence with clear business information and GDPR compliance. Technically, the site is built on WordPress with common plugins for advertising, GDPR cookie management, and user interface enhancements. It uses HTTPS with good SSL configuration and includes structured data for SEO benefits. Performance is moderate with good mobile optimization and basic accessibility features. The site integrates Google Analytics for user tracking and SmartEmailing for newsletter management. From a security perspective, the site enforces HTTPS and cookie consent but lacks advanced security headers and explicit incident response or security policy disclosures. No vulnerabilities or exposed sensitive data were detected in the provided content. The absence of WHOIS data due to privacy protection slightly reduces trust but is consistent with a small professional publication. Overall, the website presents a low-risk profile with good privacy compliance and professional content. Strategic improvements in security headers and transparency around security policies would enhance its posture further.

15
25
17
75
95
80
100
stnictechnikamagazntechnickzajmavostidesignarchitekti+3 more
WordPressjQueryAdvanced Ads pluginEasy Fancybox+2

Partner Domains:

www.spst-stineni.cz
partner
www.lesensky.cz
partner
2025-10-13T20:07:17.469Z
krajanekvesvete.cz favicon

Krajánek ve světě z.s.

krajanekvesvete.cz

55
EducationCzech RepublicsmallMEDIUM

Krajánek ve světě z.s. is a Czech non-profit organization dedicated to promoting the Czech language, literature, and culture among multilingual children aged 5 to 12 living abroad. The organization publishes a monthly magazine called Krajánek, creates educational materials, supports bilingualism and multilingualism, and offers distance learning courses and cultural projects. Their target audience primarily consists of Czech communities and mixed families living outside the Czech Republic. The website reflects a focused niche educational mission with a consistent brand and good content quality. Technically, the website is built on WordPress and uses a variety of plugins including those for download management, statistics, and interactive flipbook presentations. It integrates external services such as Google Maps API and Facebook SDK for social media engagement. The site is mobile optimized with moderate performance and basic accessibility features. SEO is basic but functional. From a security perspective, the site uses HTTPS with good SSL configuration but lacks some recommended security headers. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with a cookie consent mechanism present but no visible privacy policy or terms of service pages. WHOIS data is unavailable, likely due to privacy protection, which slightly reduces trust but is understandable for a small non-profit. Overall, the website presents a trustworthy and professional front for a small educational non-profit. Strategic improvements in privacy documentation, security headers, and WHOIS transparency could enhance trust and compliance.

45
10
2
60
72
80
100
educationnon-profitczech-languagemagazinemultilingual+2 more
WordPressjQueryGoogle Maps APIFacebook SDK+2
2025-10-13T18:57:28.431Z
eurogas.org favicon

Eurogas

eurogas.org

75
EnergyN/amediumMEDIUM

Eurogas is a European industry association representing the gas wholesale, retail, and distribution sectors. The organization focuses on promoting gas as a sustainable energy source and advocates for its members' interests within the European energy market. The website reflects a professional and consistent brand presence, targeting industry stakeholders and policymakers. The business model centers on policy advocacy, market analysis, and industry representation. The site content is relevant and well-structured, supporting the organization's mission and services. Technically, the website is built on WordPress using the Divi theme, enhanced with plugins such as Gravity Forms and Cookiebot for consent management. It integrates Google Analytics for traffic analysis and employs modern web technologies including jQuery and slick carousel. The site demonstrates good mobile optimization and SEO practices, although accessibility features are basic. Performance is moderate, with room for improvement in loading speed and accessibility. From a security perspective, the site enforces HTTPS with excellent SSL configuration and implements a comprehensive cookie consent mechanism via Cookiebot. However, it lacks explicit HTTP security headers and does not publish security policies or incident response information. No vulnerabilities or exposed sensitive data were detected in the analyzed content. The WHOIS data is privacy protected, which is typical for such organizations and does not raise immediate concerns. Overall, Eurogas's website presents a trustworthy and professional digital presence with solid privacy compliance and security posture. Strategic recommendations include enhancing security headers, publishing security and incident response policies, improving accessibility, and maintaining regular audits of third-party scripts to sustain security and compliance standards.

80
83
17
70
85
80
100
energyindustryassociationgaseuropepolicy+4 more
WordPressDivi ThemeGravity FormsCookiebot+4
2025-10-13T18:54:37.982Z
spir.cz favicon

Sdružení pro internetový rozvoj v České Republice, z.s.p.o. (SPIR)

spir.cz

58
TechnologyCzech RepublicmediumMEDIUM

SPIR (Sdružení pro internetový rozvoj v České Republice) is a prominent industry association representing key players in the Czech online economy. The organization supports growth in the online industry, advocates for fair competition, and contributes to the development of meaningful digital legislation. It operates important projects such as NetMonitor, the official measurement of Czech internet traffic, and AdMonitoring, which tracks online advertising expenditures. The website reflects a mature and professional digital presence with comprehensive content and active engagement with its members and the public. Technically, the website is built on WordPress using the Oxygen Builder framework, incorporating modern web technologies including jQuery, Google Fonts, and reputable analytics tools like Google Analytics and Gemius. The site is mobile-optimized, accessible, and SEO-friendly, providing a good user experience. Security practices include HTTPS enforcement and cookie consent management, though some security headers could be improved. From a security perspective, the site shows a solid posture with no visible vulnerabilities or exposed sensitive data. However, the absence of a published security policy, incident response contacts, or vulnerability disclosure mechanisms suggests room for improvement in transparency and readiness. The lack of WHOIS data for the domain introduces some uncertainty regarding domain legitimacy, though the professional nature of the site mitigates this risk. Overall, SPIR's website is a trustworthy and authoritative source for information about the Czech online industry, with strong compliance to privacy regulations and a clear focus on industry advocacy and service provision. Strategic recommendations include enhancing security header implementation, publishing security and incident response policies, and improving domain registration transparency.

25
25
17
70
65
80
100
internetonlineeconomydigitaladvertisingczechrepublicgdpr+3 more
WordPressOxygen BuilderjQueryGoogle Fonts (Ubuntu, Inter, Cardo)+4
2025-10-13T17:50:32.763Z
innovacareplus.cz favicon

InnovaCare Plus

innovacareplus.cz

62
HealthcareCzech RepublicmediumMEDIUM

InnovaCare Plus is a private healthcare provider based in Prague, offering premium medical services with a focus on preventive care, specialized diagnostics, and corporate health programs. The company emphasizes personalized coordination, comfort, and efficiency, targeting individuals, families, and businesses seeking high-quality healthcare without waiting times. Their digital presence includes an e-commerce platform for online service purchases and a comprehensive website showcasing their offerings and benefits. Technically, the website is built on WordPress with WooCommerce and Elementor, leveraging modern web technologies such as Google Fonts, GSAP animations, and Slider Revolution for a polished user experience. The site is mobile-optimized, accessible, and SEO-friendly, with integrated Google Analytics for user behavior tracking. Cookie consent and GDPR compliance are well implemented, reflecting a mature approach to privacy. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism, but lacks some advanced security headers which could enhance protection. No critical vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data limits domain trust verification, though the professional site content and contact information support legitimacy. Overall, InnovaCare Plus presents a strong digital and business profile with room for security enhancements and improved domain transparency. Strategic recommendations include adding security headers, publishing a security.txt file, and enhancing incident response visibility to further strengthen trust and compliance.

15
25
17
85
95
75
100
healthcareprivateclinicmedicalservicespreventivecaregdpr+2 more
WordPressWooCommerceElementorSlider Revolution+6
2025-10-13T17:48:37.377Z