Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149793
Websites
130
Industries
113
Countries
52
Avg Score
Page 128 of 238|Showing 6351-6400 of 11891
ljp.lv favicon

Biedrība „Latvijas Jaunatnes padome”

ljp.lv

50
Non-profitLatviamediumMEDIUM

Latvijas Jaunatnes padome (LJP) is a well-established non-profit organization founded in 1992, serving as the largest youth energy network in Latvia. It supports 55 youth organizations across the country, fostering a civic and supportive environment for young people. The organization offers services including training on participation, support for youth NGOs, and mentoring. The website reflects a professional and community-focused entity with clear contact information and official registration details. Technically, the website employs modern web technologies such as Google Fonts, YouTube embeds, Google Maps API, and Google reCaptcha for security. It uses HTTPS with a valid SSL configuration and includes a CSRF token, indicating attention to security. However, the absence of certain security headers and explicit security policies suggests room for improvement in security maturity. The security posture is generally good with no visible vulnerabilities or exposed sensitive data. Privacy compliance is addressed with a privacy policy and cookie consent mechanism, though GDPR compliance could be enhanced with more detailed disclosures. The website is accessible, mobile-optimized, and provides a good user experience with clear navigation and relevant content. Overall, the risk assessment is low, with no signs of malicious activity or suspicious content. Strategic recommendations include enhancing security headers, publishing incident response and vulnerability disclosure information, and improving privacy transparency to strengthen trust and compliance.

15
10
17
75
95
85
20
ljpjaunumiaktualittesviedokieiropaskomisija+15 more
Google FontsYouTube embedGoogle Maps APIGoogle reCaptcha+1
2025-07-30T16:00:28.210Z
S

SIA Puzzle

ratubirojs.lv

52
RetailLatviasmallMEDIUM

SIA Puzzle operates the Latvian e-commerce website ratubirojs.lv, specializing in baby strollers, car seats, and related accessories. The company holds exclusive representation rights for premium brands such as ABC-Design, Bebecar, and Hartan AMG Mercedes in Latvia, positioning itself as a trusted retailer for families seeking quality baby products. The website features a professional design with clear navigation, product categorization, and promotional offers, targeting parents and caregivers in Latvia. Contact information and physical warehouse/showroom addresses are prominently displayed, enhancing customer trust and accessibility. Technically, the website is built on the OpenCart platform using the Journal2 theme, integrating modern JavaScript libraries and Google Tag Manager for analytics. The site is mobile responsive and optimized for user experience, though some accessibility features could be improved. Security posture is solid with HTTPS enforced and no visible sensitive data exposure; however, the absence of security headers and cookie consent mechanisms indicates room for enhancement in compliance and protection. The WHOIS data for the domain is unavailable due to query limits, limiting the ability to verify domain registration details and ownership. Despite this, the website content and business information appear consistent and legitimate for a small Latvian retail business. No WAF or content blocking was detected, allowing full content access and analysis. Overall, ratubirojs.lv demonstrates a good level of digital maturity and business credibility in its niche market. Strategic improvements in privacy compliance, security headers, and transparency policies would further strengthen its security posture and customer trust.

20
10
2
70
65
75
100
babyproductsstrollerscarseatse-commercelatvia+1 more
Google FontsjQueryJournal2 themeRevolution Slider+3
2025-07-30T16:00:28.168Z
kokuplacis.lv favicon

SIA MDD Grupa

kokuplacis.lv

44
ManufacturingLatviasmallHIGH

The website kokuplacis.lv represents SIA MDD Grupa, a small Latvian company specializing in the sale and delivery of wood materials and related construction products. Their product range includes sawn timber, finishing boards, OSB, insulation materials, construction films, briquettes, pellets, wooden stakes, bed frames, and children's playground equipment. The site targets local construction companies and retail customers seeking wood products. The business model is primarily wholesale and retail sales within the Latvian market. Technically, the website uses Bootstrap and jQuery frameworks with Google Fonts for styling. The site is moderately optimized for performance and mobile devices but lacks advanced SEO and accessibility features. There is no detected CMS or hosting provider information. The site does not implement modern security headers or visible HTTPS enforcement in the provided data, which impacts its security posture. From a security perspective, the site lacks privacy and cookie policies, incident response contacts, and vulnerability disclosures. No WHOIS data was retrievable due to query limits, limiting domain legitimacy verification. Contact information is present and consistent with the business, but no social media or additional trust signals are found. The overall security score is moderate but could be improved by implementing HTTPS, security headers, and privacy compliance measures. Overall, the website is functional and provides relevant business information but requires improvements in security, privacy compliance, and technical modernization to enhance trustworthiness and user experience.

15
10
17
80
67
85
20
woodconstructiontimberlatviabuildingmaterials
BootstrapjQueryGoogle Fonts
2025-07-30T16:00:27.025Z
amirels.lv favicon

Vannu Dušu Studija

amirels.lv

45
RetailLatviasmallHIGH

Vannu Dušu Studija is a Latvian-based retail and e-commerce business specializing in bathroom interior products such as bathtubs, showers, sinks, toilets, faucets, towel dryers, and accessories. The website is professionally designed using PrestaShop CMS and modern frontend technologies, targeting Latvian-speaking consumers interested in bathroom renovations and interior design. The business model is focused on online retail with product catalogs and informational content to assist customers in making purchase decisions. The market position appears to be a niche local player with a consistent brand presence and good content quality. Technically, the website employs a modern tech stack including PrestaShop, jQuery, Revolution Slider, and Google Fonts. The site is mobile optimized and has good SEO practices, although accessibility features are basic. Performance is moderate with no major issues detected. Security posture is adequate with HTTPS enabled and no exposed sensitive data, but lacks security headers and explicit privacy and terms of service pages, which are recommended for improvement. The security evaluation shows no blocking or WAF challenges, indicating full content accessibility. However, the absence of WHOIS data due to query limits restricts domain legitimacy verification. No vulnerabilities or malware indicators were found in the content. Cookie consent is implemented with implied consent, but privacy compliance could be enhanced with explicit policies. Overall, the website is a legitimate small retail business with a professional online presence but would benefit from improved privacy disclosures, security headers, and WHOIS transparency to enhance trust and compliance.

20
10
2
85
72
75
20
bathroomsanitarye-commerceretaillatvia+2 more
PrestaShop CMSjQueryRevolution SliderGoogle Fonts+2
2025-07-30T16:00:26.790Z
jahtas.eu favicon

SIA BOFORS

jahtas.eu

50
TransportationLatviasmallMEDIUM

Jahtas.lv, operated by SIA BOFORS, is a well-established Latvian company specializing in the sale and servicing of new and used watercraft since 2006. The company offers a comprehensive range of services including boat sales, winter storage, summer mooring, equipment sales, engine maintenance, hull repairs, and other boat management services. Positioned as a local leader in the water transport sector, Jahtas.lv targets boat owners and maritime enthusiasts primarily in Latvia. The website reflects a professional business with clear contact information and a detailed FAQ section, supporting customer engagement and trust. Technically, the website is built on WordPress using popular plugins such as Elementor and Revolution Slider, with SEO optimization via Rank Math and analytics through Google Analytics. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and security header implementation. Hosting is managed through GoDaddy, a reputable registrar and hosting provider. From a security perspective, the site uses HTTPS and includes reCAPTCHA for form protection, but lacks explicit security headers and published security policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is limited due to the absence of privacy and cookie policies, which is a notable compliance gap. Overall, the security posture is moderate but could be enhanced with additional measures. The overall risk assessment indicates a legitimate and trustworthy business with minor compliance and security improvements recommended. Strategic focus should be on enhancing privacy compliance, implementing security headers, and publishing incident response and vulnerability disclosure information to strengthen trust and regulatory adherence.

100
75
40
75
2
15
10
boatsyachtswatercraftmarineservicesboatsales+2 more
WordPressElementorRevolution SliderjQuery+5
2025-07-30T16:00:25.974Z
tara24.lv favicon

TARA24.LV stikla burku un pudeļu tirdzniecība

tara24.lv

41
RetailLatviasmallHIGH

TARA24.LV is a Latvian-based small retail and wholesale business specializing in glass jars, bottles, and related packaging products. The company operates an e-commerce website built on the PrestaShop platform, offering a broad assortment of glass packaging solutions to customers primarily in the Baltic region. The website is professionally designed with clear navigation and product categorization, targeting both retail consumers and business clients. Contact information and business registration details are clearly presented, supporting business credibility. Technically, the website leverages modern web technologies including Google Tag Manager and Google Analytics for marketing and analytics purposes. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. Security posture is adequate with HTTPS enforced, but lacks several important HTTP security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, no major vulnerabilities or exposed sensitive data were detected. However, the absence of security headers and formal privacy compliance mechanisms suggest moderate risk. The WHOIS data could not be retrieved due to query limits, limiting domain registration verification. Overall, the website appears legitimate and trustworthy for its business scope but would benefit from enhanced security and privacy practices. Strategic recommendations include implementing comprehensive privacy and cookie policies, adding security headers, publishing a security.txt file for vulnerability disclosure, and improving accessibility compliance. These steps would strengthen the site's security posture, regulatory compliance, and user trust.

70
62
20
75
20
2
10
e-commerceretailglasspackagingprestashoplatvia
PrestaShop CMSGoogle Tag ManagerGoogle AnalyticsjQuery+2
2025-07-30T16:00:25.968Z
S

SIA IM LATVIJA

topo.lv

9
Real EstateLatviasmallCRITICAL

SIA IM LATVIJA operates as a specialized surveying and geodesy service provider in Latvia, established in 2011. The company offers a range of services including topography, execution measurements, geodesy, aerial measurements, and 3D model creation, leveraging advanced Trimble technology to ensure high precision. Their market position is that of a small, service-oriented business focused on personalized client engagement and rapid order fulfillment across Latvia. The website reflects a professional and consistent brand image with clear contact information and business credentials. Technically, the website is built on WordPress using the Divi theme, incorporating modern web technologies such as jQuery, Google Fonts, and image optimization via Optimole. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with no critical technical issues detected. However, security headers are absent, and privacy-related policies are missing, indicating areas for improvement. From a security perspective, the site benefits from HTTPS encryption but lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of privacy and cookie policies reduces compliance with GDPR and related regulations. Overall, the security posture is moderate but could be enhanced by implementing recommended best practices. The overall risk assessment suggests a legitimate, small business website with good content quality and technical implementation but with gaps in privacy compliance and security transparency. Strategic recommendations include adding privacy and cookie policies, implementing security headers, establishing incident response contacts, and publishing vulnerability disclosure information to strengthen trust and compliance.

-
-
-
-
-
-
-
surveyinggeodesytopography3dmodelinglatvia+1 more
WordPressDivi ThemejQueryGoogle Fonts+2
2025-07-30T16:00:25.931Z