Skip to main content

Technology security reports

Browse 24,081 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 459 of 482|Showing 22901-22950 of 24081
datatechnology.co.uk favicon

Data Technology Limited

datatechnology.co.uk

40
TechnologyUnited KingdommediumHIGH

Data Technology Limited is a UK-based technology consultancy specializing in data strategy, data platforms, analytics, prediction as a service, and cloud modernisation. The company targets organizations seeking to leverage data for business insights and outcomes, positioning itself as a trusted partner with recognized certifications such as Cyber Essentials and ISO QAR. Their website reflects a professional and consistent brand with clear service offerings and client endorsements. Technically, the website is built on the HubSpot CMS platform, hosted via Cloudflare, and employs modern web technologies including Google Analytics 4 and Splide.js for interactive content. The site is mobile-optimized and SEO-friendly, though performance is moderate. Accessibility features are basic but present. From a security perspective, the site lacks a valid SSL certificate and does not support modern TLS protocols, which is a significant vulnerability. While some security headers are implemented, critical improvements are needed to secure communications and protect user data. Privacy compliance is strong with clear policies and consent mechanisms in place. Overall, the website demonstrates a credible business presence with good content and marketing practices but requires urgent remediation of SSL/TLS issues to enhance security posture and trustworthiness.

45
18
5
50
-
85
100
datatechnologydatastrategyanalyticscloudmodernisationpredictionasaservice+2 more
HubSpot CMSCloudflare CDNGoogle Analytics 4Splide.js (carousel)+3
2025-06-15T21:51:18.369Z
R

RUBICON IT GmbH

rubicon.eu

40
TechnologyAustriamediumHIGH

RUBICON IT GmbH is a medium-sized Austrian technology company specializing in digitalization solutions and IT services. Their product portfolio includes leading software such as Nova Find, a prominent lost and found software in Europe, alongside other enterprise solutions like Acta Nova and Document Partner. The company also offers professional services, managed services, and training, targeting business and public sector clients seeking digital transformation. The website is professionally designed, multilingual, and well-structured, reflecting a mature digital presence. Technically, the site is built on WordPress with various plugins and frameworks, including ASP.NET components, but suffers from critical SSL/TLS misconfigurations, lacking a valid certificate and modern protocol support. Security headers are partially implemented but incomplete, and no advanced security mechanisms like OCSP stapling or session resumption are enabled. Privacy compliance is strong, with clear cookie consent and a comprehensive privacy policy. Social media integration and certifications like Kubernetes demonstrate trust and industry alignment. Overall, the site is functional and business-credible but requires urgent security improvements to protect user data and enhance trust.

45
33
5
50
-
85
100
digitalizationsoftwareitservicesmanagedservicesprofessionalservices+4 more
WordPressPHPASP.NET (X-Powered-By header)jQuery+8

Partner Domains:

nova-find.eu
partnerpending
signpath.io
partnerpending
2025-06-15T21:51:17.233Z
jawa.at favicon

JAWA Management Software GmbH

jawa.at

23
TechnologyAustriamediumCRITICAL

JAWA Management Software GmbH is an established Austrian technology company specializing in customized software solutions for process optimization and information management. Their flagship product, the inforum management platform, supports supplier management, quality control, production planning, and AI-enhanced business solutions. With over 25 years of market presence and a medium-sized operation, JAWA serves a broad international clientele with a focus on efficiency and productivity improvements. Technically, the website is built on a modern WordPress CMS infrastructure using popular plugins and frameworks such as WPBakery, WPML, and Woodmart theme. The site is well-structured, mobile-optimized, and SEO-friendly, demonstrating a mature digital presence. However, the hosting environment lacks a valid SSL certificate and proper TLS configuration, which significantly undermines the security posture. Security-wise, the absence of HTTPS and modern TLS protocols is a critical vulnerability, exposing users to potential data interception and trust issues. While no active vulnerabilities or malware are detected, the site misses essential security headers and DNS security configurations. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. Overall, the website presents a professional and credible business front but requires urgent security improvements to protect user data and enhance trust. Strategic recommendations include immediate SSL deployment, enabling modern security protocols, and implementing advanced security headers and DNS protections.

15
-
5
50
-
85
20
softwaremanagementprocessoptimizationtechnologybusinesssolutions+3 more
ApacheWordPress 6.8.1PHPjQuery+9
2025-06-15T21:51:16.418Z
U

united-domains AG

noack-vision.com

35
TechnologyGermanymediumHIGH

The website noack-vision.com is currently a placeholder page hosted by united-domains AG, indicating that the domain has been newly registered but not yet configured with any business content or services. The page serves solely to confirm domain registration and availability, providing links to the registrar's main site for domain management and related services. There is no direct business presence or operational content on this domain at this time. From a technical perspective, the site is minimalistic, using basic HTML and CSS without any advanced frameworks or CMS. It is hosted on united-domains' webspace platform but lacks HTTPS support, security headers, and performance optimizations. No analytics, tracking, or advertising technologies are present, reflecting the placeholder nature of the site. Security posture is weak due to the absence of SSL/TLS encryption and security headers, exposing visitors to potential risks if sensitive data were to be transmitted. However, since the site contains no forms or user inputs, the immediate risk is low. Privacy compliance is minimal, with no cookie consent or privacy policy hosted on the domain itself, only links to the registrar's policies. Overall, the domain is legitimate and consistent with a newly registered domain awaiting configuration. The lack of content and security features results in a low AI score and indicates no active business operations or risk factors beyond the absence of HTTPS. Strategic recommendations include securing the domain with SSL, deploying actual business content, and implementing privacy and security best practices before going live.

15
18
-
50
-
85
100
domainregistrationplaceholderunited-domainsnewdomain
HTML5CSS3
2025-06-15T21:51:16.135Z
wunderweiss.com favicon

wunderweiss

wunderweiss.com

40
TechnologyAustriasmallHIGH

Wunderweiss is a specialized agency based in Austria focusing on software and design development, with a strong emphasis on AI applications integrated into CMS systems, UI/UX consulting, and corporate branding. The company targets businesses seeking innovative technology and design solutions, positioning itself as an expert in user-oriented design and AI-driven application development. The website presents a professional and consistent brand image with detailed project showcases and clear service offerings. Technically, the website employs modern web technologies including jQuery, Django Framework, and Wagtail CMS, hosted behind Cloudflare. However, the site suffers from a critical security issue: the SSL certificate is invalid or missing, resulting in no proper HTTPS support. This significantly impacts the security posture and user trust. Performance metrics are not available, but the site shows good mobile optimization and basic accessibility features. Security-wise, the site implements several important HTTP security headers such as X-Frame-Options and Referrer-Policy, but lacks a valid SSL certificate, OCSP stapling, and session resumption. There is no visible incident response or vulnerability disclosure information. Privacy compliance is partially addressed with a comprehensive privacy policy, but no cookie consent mechanism is present. Overall, the website is professionally designed and credible from a business perspective but requires urgent remediation of its SSL configuration to improve security and trust. Strategic recommendations include fixing HTTPS, implementing cookie consent, and adding security and incident response policies.

65
-
5
50
-
85
100
aidesigntechnologysoftwaredevelopmentuiux+2 more
jQueryCloudflareGoogle Calendar integrationJavaScript+3
2025-06-15T21:51:14.554Z
O

Ookla, LLC

mosaik.com

40
TechnologyUnited StatesenterpriseHIGH

Ookla, LLC is a well-established enterprise in the telecommunications and technology sector, known for its network intelligence and performance measurement solutions. The website indicates that Mosaik was acquired by Ookla in 2018, integrating its wireless network intelligence and mapping products into Ookla's portfolio. The company targets enterprise customers including network operators, regulators, and hardware manufacturers, offering a broad suite of products such as Speedtest, Downdetector, and Ekahau. The market position is strong, supported by a large enterprise size and backing by parent company Ziff Davis. Technically, the website is built using the Eleventy static site generator and leverages modern JavaScript and CSS technologies. Hosting is on AWS infrastructure, and the site integrates multiple marketing and analytics tools including Google Tag Manager, HubSpot, and LinkedIn Insight Tag. The site is mobile optimized with good SEO practices, though accessibility features are basic. From a security perspective, the site implements several important HTTP security headers such as X-Frame-Options and Content Security Policy. However, the absence of a valid SSL certificate and lack of HTTPS enforcement are critical vulnerabilities that significantly reduce the security posture. No cookie consent mechanism was detected despite the use of tracking scripts, indicating partial privacy compliance. Overall, the website is professional and trustworthy in content and business credibility but requires urgent improvements in SSL/TLS configuration and privacy compliance to enhance security and user trust.

55
18
5
50
-
85
100
networkintelligenceenterprisesolutionstelecommunicationsnetworkperformancemapping+2 more
Eleventy static site generatorJavaScriptCSSGoogle Tag Manager+3
2025-06-15T21:51:13.184Z
ivii.eu favicon

ivii GmbH

ivii.eu

40
TechnologyAustriasmallHIGH

ivii GmbH is a small Austrian technology company specializing in AI-powered visual intelligence systems designed to optimize quality assurance and logistics processes in industrial manufacturing environments. Their flagship product, ivii iriis, combines artificial intelligence, machine learning, and camera technology to enable error-free production and logistics workflows. The company positions itself as an innovative provider with a strong focus on practical, plug-and-play solutions that empower employees and improve operational efficiency. The website content is professionally crafted, targeting industrial and logistics sectors, and supported by customer testimonials and ISO 27001 certification, enhancing trust and credibility. Technically, the website is built on WordPress with modern SEO and performance plugins such as Yoast SEO Premium and WP Rocket. However, the site suffers from a critical security shortfall due to the absence of a valid SSL certificate and HTTPS support, which significantly impacts its security posture. Performance is also suboptimal with a high page load time. Privacy compliance is well addressed with comprehensive GDPR-compliant privacy and cookie policies, including a consent mechanism. The company maintains active social media profiles and provides clear contact information. Security-wise, the lack of HTTPS and modern TLS protocols, absence of security headers, and missing DNSSEC and CAA records expose the site to potential risks. While no active vulnerabilities or WAF blocks are detected, these gaps should be addressed promptly to protect user data and maintain trust. Overall, ivii GmbH demonstrates a strong business and content presence but must urgently improve its security infrastructure to align with best practices and industry standards. Strategic recommendations include implementing SSL/TLS, enabling security headers, and optimizing performance to enhance user experience and trust.

70
-
5
50
-
85
100
aiindustrialvisionqualityassurancelogisticsmanufacturing+3 more
WordPress 6.8.1Yoast SEO PremiumWP RocketBorlabs Cookie+3
2025-06-15T21:51:04.882Z
cyledge.com favicon

CYLEDGE

cyledge.com

40
TechnologyAustriamediumHIGH

CYLEDGE is a consulting firm specializing in collaboration, customer centricity, and incremental innovation to create sustainable value. With over 20 years of market experience, the company offers tailored advisory services including value proposition design, organizational development, customer experience, and coaching. Their client portfolio includes notable companies such as VW, Siemens, and Redbull, indicating a strong market position in the technology and consulting sectors. Technically, the website is built on the Wix Studio platform using modern React 18 technology, with integrated Wix Blog and Forms for content and user engagement. However, the site suffers from slow performance and lacks a valid SSL certificate, which impacts security and user trust. Mobile optimization and accessibility are well addressed, but SEO could be improved. From a security perspective, the site lacks HTTPS and advanced security headers, which is a significant risk. No explicit security or incident response policies are found, and no vulnerabilities are detected in the current analysis. Privacy compliance is adequate with clear privacy and cookie policies, including consent mechanisms. Overall, CYLEDGE presents a professional and trustworthy business with a strong digital presence but should prioritize improving security configurations and website performance to enhance user trust and compliance.

-
33
5
50
-
85
100
consultinginnovationcustomerexperiencedigitaltransformationwix+2 more
Wix StudioReact 18Wix BlogWix Forms+7
2025-06-15T21:51:00.811Z
M

Microsoft Corporation

movere.io

40
TechnologyUnited StatesenterpriseHIGH

The website analyzed is a Microsoft Learn documentation page dedicated to Azure Migrate, a cloud migration service by Microsoft. It provides detailed, up-to-date information about new features, updates, and capabilities of Azure Migrate, targeting IT professionals and enterprises planning cloud migration. The site is part of the Microsoft Learn platform, reflecting a mature and well-established business with a strong market position in cloud services. Technically, the site leverages Microsoft Azure hosting and content delivery networks, uses modern JavaScript libraries, and integrates analytics and marketing tools such as Azure Monitor and Adobe Target. The content is well-structured, accessible, and optimized for SEO and mobile devices, providing an excellent user experience. However, a critical security issue is present: the SSL/TLS certificate is invalid or missing, and no TLS protocols are enabled, despite the presence of strict security headers like HSTS. This significantly undermines the security posture and trustworthiness of the site. Privacy policies and cookie consent mechanisms are comprehensive and GDPR compliant, consistent with Microsoft's standards. Overall, the site demonstrates high business credibility and technical maturity but requires urgent remediation of SSL/TLS configuration to ensure secure communications and maintain trust.

80
15
-
50
-
90
100
azurecloudmigrationmicrosoftlearnazuremigratedocumentation+1 more
HTML5CSS3JavaScriptAzure CDN+4
2025-06-15T21:50:51.831Z
R

Ricoh

ricoh.at

30
TechnologyAustriaenterpriseHIGH

The website ricoh.at represents a corporate entity associated with Ricoh, a recognized technology company specializing in imaging and printing solutions. However, the website content is currently inaccessible, returning a 403 Forbidden error page, which blocks access to any meaningful content or user interaction. The visible page contains minimal information, including a corporate logo and a contact email address for communication. From a technical perspective, the site lacks a valid SSL/TLS certificate and does not support HTTPS, despite having a strict-transport-security header present. No modern web technologies, analytics, or advertising tools are detected, and the site performance metrics are unavailable due to the blocked content. DNS records are properly configured with valid MX and NS entries and multiple TXT records for domain verification and SPF, indicating legitimate domain management. Security posture is weak due to the absence of HTTPS and the invalid SSL configuration, which is a critical issue. No privacy, cookie, or terms of service policies are found, indicating poor privacy compliance. The domain registration data is consistent with a legitimate corporate entity, but the lack of accessible content and security controls significantly reduces trustworthiness and usability. Overall, the site is currently non-functional for end users and presents critical security and compliance gaps. Immediate remediation is required to install a valid SSL certificate, enable HTTPS, and provide accessible content with appropriate privacy and security policies to improve trust and compliance.

30
-
5
50
-
85
100
2025-06-15T21:50:28.390Z
webroot.com favicon

Webroot

webroot.com

40
TechnologyUnited StatesenterpriseHIGH

Webroot, a subsidiary of Open Text Corporation, is a well-established cybersecurity company founded in 2004, providing multi-vector protection solutions for endpoints, networks, and identity protection. The company targets both home users and businesses, offering a broad portfolio of products including antivirus, identity protection, cloud backup, VPN, and threat intelligence services. The website reflects a mature enterprise with consistent branding, comprehensive content, and strong market positioning supported by industry awards and customer testimonials. Technically, the website is built on a Concrete5 CMS platform, leveraging Apache server technology, jQuery, Google Fonts, and is delivered via Imperva CDN. While the site is mobile-optimized and accessible with good SEO practices, performance data is limited and suggests moderate speed. The site uses modern marketing and analytics tools such as Google Tag Manager and Sitespect for tracking and optimization. From a security perspective, the site lacks a valid SSL certificate and does not support HTTPS or modern TLS protocols, which is a critical vulnerability exposing users to potential interception and attacks. Security headers are partially implemented but key protections like HSTS and OCSP stapling are missing. No explicit security policy or incident response information is provided, which could be improved to enhance trust and compliance. Overall, the website demonstrates high business credibility and content quality but suffers from significant security configuration issues that must be addressed to protect users and maintain compliance. Strategic improvements in SSL/TLS deployment and security best practices are recommended to elevate the security posture and user trust.

20
15
5
50
-
90
100
cybersecurityendpointprotectionidentityprotectioncloudbackupvpn+4 more
ApachejQueryGoogle FontsImperva CDN+3

Partner Domains:

opentextcybersecurity.com
partnerpending
brightcloud.com
partnerpending
2025-06-15T21:49:51.172Z
superangels.club favicon

European Super Angels Club

superangels.club

43
TechnologyAustriasmallHIGH

European Super Angels Club is a pan-European investment club targeting business angels, high-net-worth individuals, family offices, and corporate venture capital units. It facilitates investments in technology startups, particularly in smart mobility, by providing access to curated deals, due diligence support, and a strong network of partners and co-investors. The website presents a professional image with detailed information about membership benefits, partners, and events, positioning itself as a key player in the European startup investment ecosystem. Technically, the website is built on WordPress using the Enfold theme and integrates various plugins for SEO, analytics, and content presentation. However, the site suffers from slow load times and lacks a valid SSL certificate, which is a critical security flaw. The absence of modern TLS protocols and security headers further weakens its security posture. The site is mobile-optimized and SEO-friendly but lacks cookie consent mechanisms despite using tracking tools. From a security perspective, the lack of HTTPS and security headers exposes users to risks and undermines trust. The WHOIS data shows a mature domain with privacy protection justified by the business nature. No WAF or blocking mechanisms are detected, allowing full content access. Overall, the site demonstrates moderate business credibility but requires urgent security improvements to protect users and enhance trust. Strategically, the club should prioritize SSL implementation, enhance security headers, and introduce privacy compliance features such as cookie consent to align with GDPR. Improving site performance and accessibility will also benefit user experience and SEO rankings.

15
43
25
50
75
75
40
investmentstartupbusinessangelsventurecapitaleurope+2 more
WordPressEnfold ThemeYoast SEOGoogle Analytics (ExactMetrics plugin)+4
2025-06-15T21:49:37.113Z
F

fiskaly GmbH

fiskaly.com

40
TechnologyGermanymediumHIGH

fiskaly GmbH is a technology company specializing in cloud-based fiscalization solutions tailored for European markets including Germany, Austria, Spain, Italy, and France. Their services focus on enabling retailers and POS providers to comply with complex fiscal regulations through APIs and cloud services. fiskaly holds a strong market position as a leading provider of cloud TSS solutions in Germany and is expanding its footprint across Europe. The website demonstrates a professional, well-branded presence with comprehensive content, customer testimonials, and partner endorsements. Technically, the website is built on a modern Next.js framework hosted on Netlify, leveraging React and various marketing and analytics tools such as Google Tag Manager and Visual Website Optimizer. The site is mobile-optimized and accessible, with good SEO practices. However, a critical security issue is present due to an invalid or missing SSL certificate and disabled TLS protocols, which significantly impacts the security posture. Security-wise, fiskaly implements several best practices including HSTS and security headers, and holds ISO 27001 certification, indicating a mature security framework. Despite this, the lack of a valid SSL certificate and TLS support is a major vulnerability that must be addressed urgently to protect user data and maintain trust. Overall, fiskaly presents a credible and professional business with strong compliance and technical capabilities but must remediate critical SSL/TLS issues to ensure secure and trustworthy operations online.

40
18
5
50
-
85
100
companyculturecustomersuccessstorye-invoicefaq+6 more
Next.jsReactNetlifyJavaScript
2025-06-15T21:49:27.021Z
sensorbis.com favicon

Sensorbis GmbH

sensorbis.com

18
TechnologyGermanysmallCRITICAL

Sensorbis GmbH operates a cloud-based telemetry data management platform focused on Internet of Things (IoT) devices and sensors. The company provides subscription services enabling users to acquire, store, visualize, and export telemetry data with real-time charts, maps, and alert notifications. Their target audience includes IoT device operators, industrial machinery managers, and fleet tracking services. The business model centers on SaaS subscriptions with API and web interface management capabilities. The website content is professionally presented with consistent branding and relevant business descriptions, positioning Sensorbis as a niche player in the IoT telemetry cloud market. Technically, the website is built on ASP.NET WebForms with jQuery and Bootstrap, indicating a mature but somewhat dated technology stack. Performance is moderate to slow with a page load time exceeding 5 seconds and a large page size. Mobile optimization and accessibility are basic but functional. The site includes cookie consent mechanisms and privacy policy documentation, though GDPR compliance is not explicitly confirmed. Analytics tracking is present but disabled. From a security perspective, the site suffers from critical issues including the absence of a valid SSL certificate, missing DNS records, and lack of security headers. HTTPS is enforced in the application logic but without a valid certificate, exposing users to risks. No advanced security policies or incident response contacts are published. These vulnerabilities significantly reduce the security posture and trustworthiness of the site. Overall, Sensorbis GmbH presents a credible small technology company with a focused IoT telemetry service offering. However, critical security improvements are necessary to protect user data and enhance trust. Addressing SSL and DNS issues should be prioritized to improve the security score and user confidence.

15
-
-
50
-
50
-
iottelemetryclouddatavisualizationsensors+2 more
ASP.NET WebFormsjQuery 2.2.4BootstrapGoogle Fonts (Lato)+1

Partner Domains:

sensorbis.cloud
partnerpending
2025-06-15T21:49:26.025Z
gentics.com favicon

Gentics Software GmbH

gentics.com

37
TechnologyAustriamediumHIGH

Gentics Software GmbH is a medium-sized technology company based in Austria specializing in enterprise content management solutions, e-government digital services, and customized software applications. Their website presents a professional and consistent brand image targeting enterprises and government agencies seeking digital transformation and content management platforms. The company offers a range of products including the Gentics Content Management Platform and related extensions. Technically, the website uses modern frameworks such as Bootstrap 5 and implements a GDPR-compliant cookie consent mechanism with opt-in functionality. However, the site lacks a valid SSL certificate and does not serve content over HTTPS, which is a critical security shortfall. Performance is moderate with acceptable load times and resource counts, and the site is mobile optimized with basic accessibility features. From a security perspective, the absence of HTTPS and security headers significantly lowers the security posture. No incident response or security policy information is publicly available, and no contact information is provided on the site, which may impact user trust and compliance. DNS records show standard email protection via SPF but lack DNSSEC and CAA records. WHOIS data is consistent and supports the legitimacy of the domain and business. Overall, while the business and content quality are good, the lack of HTTPS and security best practices present a significant risk. Strategic improvements in SSL deployment, security headers, and contact transparency are recommended to enhance trust and compliance.

15
18
-
50
-
85
100
enterprisecontentmanagemente-governmentsoftwaredigitaltransformationcookieconsent+1 more
Bootstrap 5.3.2CookieConsent v3HTML5CSS3+2
2025-06-15T21:49:25.670Z