Skip to main content

Real Estate security reports

Browse 3,974 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157364
Websites
130
Industries
113
Countries
52
Avg Score
Page 9 of 80|Showing 401-450 of 3974
bagshaws.com favicon

Bagshaws LLP

bagshaws.com

51
Real EstateUnited KingdommediumMEDIUM

Bagshaws LLP is a well-established UK-based firm specializing in rural property, livestock, and machinery auctioneering, with a history dating back to 1871. The company offers a broad range of professional services including chartered surveying, property sales and lettings, and farm office services, targeting farmers, landowners, and rural clients primarily in Derbyshire and Staffordshire. The website reflects a mature digital presence with comprehensive service descriptions and strong branding consistency. Technically, the website is built on WordPress with modern plugins such as Gravity Forms and PropertyHive, integrating Google Analytics and reCAPTCHA for analytics and security. The site is mobile-optimized and demonstrates good SEO and accessibility practices. However, the absence of WHOIS data and lack of visible security headers are notable gaps in transparency and security hardening. Security posture is generally good with HTTPS enforced and cookie consent mechanisms in place, but the lack of a published security policy or incident response contacts limits the site's security maturity. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear cookie and privacy policies aligned with GDPR requirements. Overall, the site presents a professional and trustworthy business front but would benefit from improved domain transparency and enhanced security disclosures to strengthen trust and compliance.

47
20
75
65
83
20
17
realestateagricultureauctioncharteredsurveyorslivestock+3 more
WordPress 6.9.4PHPjQueryGravity Forms+3
2026-06-28T07:21:10.416Z
B

Britannia Property Services

britanniapropertyservices.com

44
Real EstateUnited KingdomsmallHIGH

Britannia Property Services operates as a property management and lettings company specializing in student and professional accommodation in Birmingham, UK. Their services include tenancy management, portfolio property management, and property maintenance and refurbishment. The website presents a professional image with clear service offerings and trust indicators such as industry accreditations. However, the domain WHOIS data is missing or inaccessible, which raises concerns about domain legitimacy and registration status. Technically, the website uses legacy JavaScript libraries like jQuery 2.0.3 and includes Google reCAPTCHA for form security. The site is mobile optimized and has a moderate performance profile but lacks visible security headers and cookie consent mechanisms, indicating gaps in security and privacy compliance. No social media presence or company emails are publicly listed, limiting direct contact options. From a security perspective, the site shows basic protections but lacks advanced security headers and incident response information. The absence of WHOIS data and privacy policies reduces trustworthiness. Overall, the site is functional and professional but requires improvements in security posture, privacy compliance, and domain registration transparency. Strategic recommendations include implementing comprehensive security headers, enforcing HTTPS, adding cookie consent for GDPR compliance, clarifying domain registration status, and enhancing contact transparency to improve user trust and regulatory compliance.

70
17
15
53
60
20
47
realestatelettingspropertymanagementstudentaccommodationbirmingham
jQuery 2.0.3jQuery UIGoogle reCAPTCHAYandex Translate Widget+2
2026-06-28T07:20:22.908Z
eclipseprocurement.com favicon

Eclipse Procurement Limited

eclipseprocurement.com

45
Real EstateUnited KingdomsmallHIGH

Eclipse Procurement Limited is a UK-based small enterprise specializing in procurement solutions for the construction industry. Founded in 2010, the company offers a comprehensive range of services including strategic procurement, package procurement, supply chain management, system and process development, ISO certification assistance, and specialist recruitment. Their client base includes contractors, developers, and consultants across both public and private sectors in the UK. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress using Elementor and standard web technologies such as jQuery and Bootstrap. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enabled and domain transfer protections in place, but lacks advanced security headers and published security policies. Privacy compliance is limited due to the absence of a cookie consent mechanism and GDPR indicators. Overall, the website demonstrates a solid business presence with trustworthy indicators such as ISO certifications and a professional leadership team. However, it would benefit from enhanced security practices, privacy compliance improvements, and clearer contact information to strengthen trust and regulatory adherence.

85
20
70
37
15
53
2
procurementconstructionisocertificationsupplychainstrategicprocurement+1 more
WordPressElementorjQueryBootstrap+1
2026-06-27T07:19:20.145Z
matthew-homes.com favicon

Matthew Homes

matthew-homes.com

50
Real EstateUnited KingdommediumMEDIUM

Matthew Homes is an established UK-based home builder with a heritage dating back to the 1950s, specializing in residential property developments across London and the South East of England. The company offers a diverse range of homes and aftersales services, positioning itself as a trusted builder with a focus on quality and style. Their website reflects a professional and consistent brand image, targeting home buyers in the UK market. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Analytics, Google Tag Manager, and Google reCAPTCHA for form security. The site is moderately performant, mobile-optimized, and SEO-friendly, though accessibility features are basic. Hosting and domain registration are stable and transparent, with no privacy protection on WHOIS data, indicating legitimacy. From a security perspective, the site uses HTTPS with a valid SSL configuration and employs reCAPTCHA to protect forms. However, DNSSEC is not enabled, and no explicit security headers were detected, which are areas for improvement. Privacy compliance is partially addressed with a comprehensive privacy policy but lacks a cookie consent mechanism. Contact information is clearly presented, enhancing business credibility. Overall, the website presents a low-risk profile with good business credibility and technical implementation. Strategic improvements in security headers, DNSSEC, and privacy consent mechanisms would enhance the security posture and compliance standing.

44
75
20
75
30
17
53
realestatehomebuildingpropertydevelopmentukconstruction+1 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+3
2026-06-27T07:13:23.890Z
R

Resin Bound Gravel Ltd.

resinboundgravel.org

50
Real EstateUnited KingdomsmallMEDIUM

Resin Bound Gravel Ltd. is a UK-based company specializing in the supply and installation of resin bound and resin bonded gravel paving solutions for residential, commercial, and industrial clients. The company positions itself as the UK's leading supplier and installer of resin bound gravel, offering a wide range of products and services including driveways, pathways, patios, and commercial hard landscaping. Their website reflects a professional business with a clear focus on quality and customer service, supported by certifications such as CHAS and Constructionline. Technically, the website is built on WordPress using the Divi theme, leveraging standard web technologies like jQuery and MediaElement.js. The site is hosted behind Cloudflare DNS but lacks advanced security configurations such as DNSSEC and security headers, which could be improved. The website is mobile-optimized with good navigation and content relevance but lacks privacy and cookie policies, which are important for compliance. From a security perspective, the site uses HTTPS and has domain registration protections in place, but the absence of security headers and vulnerability disclosure policies indicates room for improvement. No signs of WAF blocking or malicious content were detected, and the site is safe for general audiences. Overall, Resin Bound Gravel Ltd. presents a credible and professional online presence with moderate technical maturity and security posture. Strategic enhancements in privacy compliance and security best practices would strengthen their digital trust and compliance standing.

42
100
70
60
35
2
15
resinboundgraveldrivewayspavingconstructionresindriveways+2 more
WordPress 5.4.19Divi Theme 3.21.1jQuery 1.12.4MediaElement.js+2
2026-06-27T07:11:10.716Z
3bm.co.uk favicon

Fusion Project Management Ltd

3bm.co.uk

56
Real EstateUnited KingdommediumMEDIUM

3BM Ltd is a UK-based professional services company specializing in property-related consultancy, architecture, planning, project management, and cost consultancy. Established in 2013 and now part of the RSK Group, 3BM serves both public and private sectors with a strong focus on education, government, and real estate projects. The company leverages a skilled workforce and strategic partnerships to deliver innovative and cost-effective solutions. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, positioning 3BM as a reputable player in its market segment. Technically, the website is built on WordPress with modern plugins such as WPBakery and Yoast SEO, ensuring good SEO and content management capabilities. The site uses HTTPS with a good SSL configuration and includes cookie consent mechanisms aligned with GDPR requirements. While some security headers are not explicitly detected, the overall security posture is solid with no visible vulnerabilities or exposed sensitive data. The security posture is enhanced by the use of reputable plugins and the presence of ISO certifications and professional memberships, which also serve as trust indicators. The site includes clear contact information and social media links, supporting transparency and user engagement. No signs of malicious activity or content safety concerns were found, and the site is fully accessible without WAF or blocking mechanisms. Overall, 3BM's digital presence is professional, secure, and compliant, supporting its business credibility and market positioning. Strategic recommendations include enhancing security headers, maintaining regular updates, and considering publication of a dedicated security or incident response policy to further strengthen trust and compliance.

54
70
85
20
17
40
80
propertyservicesarchitectureprojectmanagementconsultancyeducationsector+2 more
WordPress 6.7.5WPBakery Page BuilderYoast SEOjQuery+2

Partner Domains:

3bmstudio.co.uk
subsidiary
fusion-pm.co.uk
subsidiary

+1 more partners

2026-06-27T07:09:40.332Z
C

Carlsons Solicitors

carlsonssolicitors.com

66
Real EstateUnited KingdomsmallMEDIUM

Carlsons Solicitors is a full-service law firm based in London, serving both national and international clients. The firm is recognized in The Legal 500 UK 2026, indicating a strong market position and reputable service offering. Their key services include family law, residential conveyancing, probate, debt recovery, immigration, and dispute resolution. The website targets individuals and businesses seeking professional legal assistance, emphasizing client relationships and personalized service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Google Analytics, Google Tag Manager, and the Plyr video player. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, typical for a CMS-based site with multimedia content. From a security perspective, the site enforces HTTPS and implements a cookie consent banner, but lacks advanced security headers such as HSTS and Content-Security-Policy. No explicit security or incident response policies are published, which could be improved to enhance trust and compliance. The WHOIS data is unavailable, which reduces transparency and trustworthiness, though the professional content and client testimonials mitigate some concerns. Overall, the website presents a professional and trustworthy image suitable for a law firm, but could benefit from enhanced security practices and clearer privacy documentation to improve compliance and user trust.

80
54
100
75
17
35
95
lawfirmlegalservicesfamilylawconveyancingdisputeresolution+2 more
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerjQuery+2
2026-06-27T07:09:03.204Z
kendallkingscott.co.uk favicon

Kendall Kingscott

kendallkingscott.co.uk

54
Real EstateUnited KingdommediumMEDIUM

Kendall Kingscott is a well-established inter-disciplinary construction consultancy based in the UK, with a 60-year history of providing integrated architectural, surveying, project management, and low carbon consultancy services. The company targets clients in sectors such as education, healthcare, residential, commercial, and public sectors, emphasizing a holistic and collaborative approach branded as '1 Team'. The website reflects a mature digital presence with professional design, multimedia content, and clear navigation. Technically, the site uses modern JavaScript modules, Google Tag Manager for analytics, and Vimeo for video content, indicating a moderate to advanced digital infrastructure. Security posture is generally good with HTTPS and cookie consent mechanisms in place, but lacks explicit security headers and visible incident response policies. The domain WHOIS data is unavailable due to a naming rules violation error from Nominet UK, which is unusual and reduces domain trustworthiness, though the website content and business information appear legitimate and professional. Overall, the site scores well on content quality, technical implementation, and privacy compliance, but domain registration opacity and missing security policies slightly reduce the trust score.

40
70
27
90
55
2
68
constructionconsultancyarchitectureprojectmanagementbuildingsurveying+2 more
JavaScript ES modulesGoogle Tag ManagerVimeo video embeddingFlickity carousel+2

Partner Domains:

ournameismud.co.uk
partner
2026-06-27T07:07:00.876Z
ulyettlandscapes.com favicon

Ulyett Landscapes Ltd

ulyettlandscapes.com

55
Real EstateUnited KingdommediumMEDIUM

Ulyett Landscapes Ltd is a well-established landscaping and grounds maintenance company based in the United Kingdom, founded in 1967. The company serves both commercial and domestic clients, maintaining over 300 sites and offering a wide range of services including tree surgery, artificial grass installation, hard and soft landscaping, fencing, and seasonal services such as gritting and snow clearance. Their market position is strong within the East Midlands region, supported by multiple industry certifications and a solid reputation evidenced by positive customer reviews. The website reflects a professional business model focused on service delivery and client satisfaction. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, Contact Form 7, and Complianz GDPR Cookie Consent, indicating a mature digital infrastructure. The site is mobile-optimized, SEO-friendly, and integrates Google Tag Manager and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement and CAPTCHA protection on forms, although some security headers are not explicitly detected and DNSSEC is not enabled, representing areas for improvement. From a security perspective, the website demonstrates good practices with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with clear cookie consent mechanisms and a comprehensive privacy policy. However, there is no explicit incident response or vulnerability disclosure information available, which could be enhanced to improve security posture. Overall, the domain registration data aligns well with the business claims, supporting the legitimacy and trustworthiness of the site. The overall risk assessment is low, with the website presenting a professional, secure, and compliant digital presence. Strategic recommendations include implementing additional security headers, enabling DNSSEC, and adding incident response contact details to further strengthen…

100
85
50
-
15
10
95
landscapinggroundsmaintenancetreesurgeryartificialgrasscommerciallandscaping+3 more
WordPressYoast SEOContact Form 7Complianz GDPR Cookie Consent+5
2026-06-27T07:06:39.639Z
T

Tuntum Housing Association

tuntum.co.uk

60
Real EstateUnited KingdommediumMEDIUM

Tuntum Housing Association is a well-established non-profit social housing provider based in Nottingham, UK, serving the East Midlands region. The organization focuses on delivering affordable, good quality homes and support services to people in housing need, including low-income individuals and vulnerable groups. Their market position is that of a trusted regional social landlord with a history dating back to 1998. Key services include homes to rent and buy, supported housing, independent living, and homelessness support. The website reflects a professional and community-focused business model with clear target audience engagement. Technically, the website is built on a modern WordPress CMS platform using Elementor and Yoast SEO plugins, ensuring good SEO and user experience. The site uses HTTPS with strong SSL configuration, integrates Google Analytics for visitor insights, and employs CookieYes for GDPR-compliant cookie consent management. The site is moderately performant and mobile-optimized, though accessibility features are basic. From a security perspective, the website demonstrates good practices such as HTTPS enforcement, cookie consent with detailed categories, and Google reCAPTCHA integration. No critical vulnerabilities or exposed sensitive data were detected. However, some security headers could be improved for enhanced protection. Privacy compliance is strong with a comprehensive privacy policy and cookie management. Overall, the website and domain exhibit high legitimacy and trustworthiness, supported by consistent WHOIS data and a long domain age. The site is safe for general audiences with no adult or questionable content. Strategic recommendations include enhancing security headers, improving accessibility, and adding explicit security and incident response policies to further strengthen the security posture.

32
85
70
100
20
83
2
socialhousingaffordablehomeseastmidlandsnon-profitcommunityservices+1 more
WordPress 7.0Elementor 4.1.4Yoast SEO 27.9jQuery 3.7.1+4
2026-06-26T07:21:27.583Z
simply2let.com favicon

Simply 2 Let Limited

simply2let.com

52
Real EstateUnited KingdomsmallMEDIUM

Simply 2 Let Limited is a small, established property letting and management company based in Great Yarmouth, UK. The company provides dedicated services to landlords and tenants, focusing on local lettings and property management. Their website reflects a professional and consistent brand image with clear contact details and service descriptions. The business appears to have been founded around 2017, aligning with the website's published content dates. Technically, the website is built on WordPress using common plugins such as Contact Form 7 and Cookie Consent, with integration of Google Maps API for location services. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features are basic. Performance is moderate with no major technical issues detected. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism, but lacks important security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were found in the content. The absence of WHOIS registration data is a significant concern, impacting the overall trustworthiness of the domain. Overall, the website is functional and professional but would benefit from improved security practices and verification of domain registration to enhance trust and compliance.

20
65
2
60
37
60
100
lettingpropertymanagementgreatyarmouthrealestatelandlords+1 more
jQueryGoogle Maps APIContact Form 7Cookie Consent plugin+1
2026-06-26T07:12:38.434Z
E

Easy Access Self Storage

easyaccessselfstorage.co.uk

56
Real EstateUnited KingdomsmallMEDIUM

Easy Access Self Storage is a UK-based self storage service provider operating since 2006, with multiple locations in Stockport, Manchester, Trafford, and Ashton Under Lyne. The company offers a wide range of storage solutions for personal and business customers, including vehicle and boat storage, archive storage, office and retail units, and workshop spaces. Their market position is that of a local/regional provider with competitive pricing and customer-centric services. The website reflects a mature business with clear branding and consistent messaging. Technically, the website is built on WordPress with WooCommerce and Gravity Forms, leveraging modern web technologies such as Bootstrap and Font Awesome. It integrates Google Analytics and Tag Manager for tracking and marketing purposes. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Hosting is provided by a reputable UK registrar and hosting provider. From a security perspective, the site uses HTTPS with good SSL configuration and security headers. No critical vulnerabilities or exposed sensitive data were detected. However, the site lacks a publicly available security policy, incident response contacts, and vulnerability disclosure mechanisms, which are recommended for enhanced trust and compliance. Overall, the website is professional, trustworthy, and serves its business purpose well. Strategic improvements in security transparency and accessibility could further strengthen its posture and customer confidence.

27
100
50
70
15
17
88
selfstoragestorageunitsbusinessstoragepersonalstoragemanchester+3 more
WordPressWooCommerceGravity FormsGoogle Analytics+2
2026-06-26T07:09:24.595Z
rdjshutters.co.uk favicon

RDJ Shutters Ltd

rdjshutters.co.uk

60
Real EstateUnited KingdomsmallMEDIUM

RDJ Shutters Ltd is a UK-based small business specializing in bespoke interior window shutters and wooden blinds, serving customers primarily in Hertfordshire but with a national reach. The company emphasizes quality, bespoke service including free home visits, expert advice, and professional measuring and fitting. Their market position is strengthened by accreditation as a Which Trusted Trader and positive client testimonials. The website reflects a professional and trustworthy business with clear contact channels and detailed product offerings. Technically, the website is built on WordPress with a modern tech stack including jQuery, Gravity Forms for data collection, and SEO optimization via Yoast. Hosting is provided by Zen Internet Limited, a reputable UK provider. The site performs moderately well with good mobile optimization and basic accessibility features. Analytics and user behavior tracking are implemented using Google Analytics and Hotjar, indicating a moderate level of digital maturity. From a security perspective, the site uses HTTPS with good SSL configuration and employs basic security best practices such as form validation and spam protection. However, it lacks advanced security headers like Content Security Policy and does not provide a security policy or incident response information. Privacy compliance is partial; a privacy policy and terms of service are present, but no cookie consent mechanism is detected. Overall, the website presents a low-risk profile with strong business credibility and a solid technical foundation. Strategic improvements in privacy compliance and security policy transparency would enhance trust and regulatory adherence.

65
53
2
85
37
60
100
windowshuttersbespokeshuttersinteriorshutterswoodenblindshomeimprovement+2 more
jQueryGravity FormsYoast SEOHotjar+2
2026-06-26T07:08:53.129Z
bwswindows.co.uk favicon

BWS Windows Ltd

bwswindows.co.uk

57
Real EstateUnited KingdomsmallMEDIUM

BWS Windows Ltd is a small UK-based manufacturer and installer specializing in bespoke windows, doors, and roof lanterns, primarily serving Bedfordshire, London, Surrey, and surrounding areas. The company operates a showroom in Bedford and caters to both trade and domestic customers. Their product offerings include uPVC and aluminium systems, with a focus on quality and competitive pricing. The website reflects a professional and trustworthy business with clear contact channels and customer testimonials. Technically, the website is built on WordPress with modern technologies such as jQuery and Font Awesome, optimized for mobile devices and SEO. The presence of Yoast SEO plugin and Google Analytics indicates a focus on digital marketing and performance tracking. Hosting is provided by 123-Reg Limited, a reputable UK registrar and hosting provider. From a security perspective, the site enforces HTTPS, includes standard security headers, and uses secure forms with validation. However, it lacks explicit security policies, incident response information, and vulnerability disclosure mechanisms. Privacy compliance is addressed with visible privacy and cookie policies and a consent mechanism, aligning with GDPR requirements. Overall, the website presents a low-risk profile with good business credibility and technical implementation. Strategic improvements could include adding detailed security policies, incident response contacts, and enhancing accessibility features to further strengthen trust and compliance.

75
65
40
57
83
50
2
doubleglazingwindowsdoorsbedfordupvc+3 more
WordPressjQueryFont AwesomeYoast SEO
2026-06-26T07:01:59.528Z
annadaleroofing.co.uk favicon

Annadale Roofing Ltd

annadaleroofing.co.uk

42
Real EstateUnited KingdomsmallHIGH

Annadale Roofing Ltd is a well-established roofing company based in Bootle, Merseyside, with a history dating back to 1985. The company specializes in a wide range of roofing services including roof repairs, replacements, flat roofs, chimney repairs, and guttering, primarily serving the Liverpool, Wirral, and broader Merseyside area. Their market position is that of a trusted local expert with a focus on quality workmanship and customer satisfaction, supported by certifications such as Trustmark and NFRC membership. Technically, the website employs modern web technologies including Bootstrap, jQuery, Owl Carousel, and Google Analytics for tracking. The site is mobile-optimized with good navigation and SEO practices, hosted by Heart Internet Limited. However, there is room for improvement in accessibility and performance optimization. From a security perspective, the website benefits from HTTPS encryption and does not expose sensitive data. However, it lacks important security headers and published security policies such as privacy, cookie, and incident response policies. The absence of these policies represents a compliance gap, especially regarding GDPR. No vulnerabilities or suspicious patterns were detected in the visible content. Overall, the website presents a professional and trustworthy front for the business but should prioritize adding privacy and cookie policies, enhancing security headers, and publishing incident response information to improve compliance and security posture. These steps will strengthen customer trust and reduce potential legal and security risks.

57
60
20
70
35
15
2
roofingroofersliverpoolmerseysideflatroofs+3 more
Bootstrap CSSjQueryOwl CarouselGoogle Fonts+1
2026-06-25T07:27:26.594Z
P

Places for People

placesforpeople.co.uk

59
Real EstateUnited KingdomlargeMEDIUM

Places for People is a UK-based leading social enterprise focused on building homes and supporting thriving communities across the country. Their website clearly communicates their mission to improve lives through housing and community development, offering services such as homes to rent and buy, community projects, and tenant support. The organization holds recognized certifications like Great Place To Work 2024 and Disability Confident Employer, reinforcing their credibility and social commitment. Technically, the website is built on the Umbraco CMS platform, leveraging modern JavaScript frameworks like Alpine.js and includes Google Tag Manager for analytics. The site is well-optimized for mobile devices, accessible, and SEO-friendly, with comprehensive privacy and cookie policies that include user consent mechanisms, indicating good privacy compliance. Security posture is strong with HTTPS enforced and appropriate security headers present, though explicit security policy documentation and incident response contacts are not found. The WHOIS lookup for the exact subdomain failed due to querying a subdomain rather than the registered domain, but the website content and branding strongly indicate legitimacy. Overall, the site presents a professional, trustworthy, and well-maintained digital presence for a large social enterprise in the real estate and non-profit sector.

49
75
100
70
2
25
68
socialenterprisehousingcommunityukrealestate+1 more
Google Tag ManagerCookie ScriptAlpine.jsLazySizes+1
2026-06-25T07:26:28.693Z