Skip to main content

Hospitality security reports

Browse 6,595 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157365
Websites
130
Industries
113
Countries
52
Avg Score
Page 74 of 132|Showing 3651-3700 of 6595
keepmybag.lv favicon

Keep my bag

keepmybag.lv

40
HospitalityLatviasmallHIGH

Keep My Bag operates an automated luggage storage service located in the heart of Riga's Old City Center, targeting travelers and tourists seeking secure and convenient luggage storage solutions. The website presents a professional and user-friendly interface with clear descriptions of services, pricing, and contact information. The business model revolves around renting automated lockers with PIN access, providing a hands-free experience for customers exploring Riga. Technically, the website is built on WordPress and integrates Google Analytics, Google Tag Manager, and Google Maps API for tracking and location services. The site is mobile-optimized with responsive design and uses modern web fonts. However, there is no evidence of advanced security headers or explicit privacy and cookie policies, which are important for compliance and user trust. From a security perspective, the site uses HTTPS (implied by URLs), but lacks visible security headers and formal privacy or incident response policies. No forms collecting sensitive data were found, reducing immediate risk exposure. The absence of WHOIS data limits domain legitimacy verification, but the website content and contact details appear consistent with a legitimate small business. Overall, the website scores moderately well in content quality, business credibility, and technical implementation but falls short in privacy compliance and security best practices. Strategic improvements in privacy policy publication, security headers implementation, and WHOIS transparency would enhance trust and compliance.

15
10
2
70
72
75
-
luggagestoragerigaautomaticlockertravelservicesecurestorage
Google AnalyticsGoogle Tag ManagerGoogle Maps APIMontserrat font from Google Fonts
2025-07-30T16:00:26.148Z
travelventspils.lv favicon

Brīvdienu māja PODNIEKI

travelventspils.lv

51
HospitalityLatviasmallMEDIUM

The website travelventspils.lv represents a small family-friendly guest house named Brīvdienu māja PODNIEKI located in Ventspils, Latvia. The business focuses on hospitality services catering primarily to families with children and tourists visiting the region. The site provides accommodation booking information primarily via phone and WhatsApp, with additional tourist information links to the official Ventspils tourism site. The market position is local and niche, targeting visitors seeking a family-oriented stay in Ventspils. Technically, the website is built on the Mozello CMS platform and leverages Amazon CloudFront CDN for content delivery. It uses legacy JavaScript libraries such as jQuery 2.2.4 and plugins like Fancybox3 for UI components. The site is moderately optimized for mobile devices and has basic SEO and accessibility features. However, there is no evidence of advanced frameworks or modern JavaScript technologies. From a security perspective, the site lacks visible security headers and privacy or cookie policies, which are critical for GDPR compliance given its European location. No WHOIS data was retrievable due to query limits, limiting domain legitimacy verification. The site uses HTTPS (implied by canonical URL) but lacks explicit security best practices such as CSP or HSTS headers. Contact information is limited to phone numbers without email or contact forms, reducing attack surface but also limiting user engagement options. Overall, the website is functional and appropriate for its business purpose but shows gaps in privacy compliance and security hardening. The absence of WHOIS data and privacy policies reduces trustworthiness from a compliance standpoint. Strategic improvements in security headers, privacy documentation, and WHOIS transparency would enhance the site's credibility and compliance posture.

20
10
2
60
75
75
100
hospitalityguesthousefamilyfriendlyventspilslatvia+2 more
jQuery 2.2.4Fancybox3BannerplayResponsiveVideos+1
2025-07-30T16:00:25.993Z
hotelstelles.lv favicon

SIA GIK

hotelstelles.lv

60
HospitalityLatviasmallMEDIUM

Hotel Stelles, operated by SIA GIK, is a small hospitality business located in Tukums, Latvia, specializing in group accommodation and event space rental for up to 50 people. The website offers detailed information about their rooms, event halls, and catering options, targeting groups and business clients seeking comfortable lodging and venues for seminars, banquets, and social gatherings. The business maintains a local market position with clear contact channels and social media presence, enhancing customer engagement and trust. Technically, the website is built on the MultiScreenSite platform, utilizing modern web technologies including jQuery, Google Analytics, Google Tag Manager, and service workers for PWA capabilities. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features are basic, and security headers are not explicitly detected, though HTTPS is properly enforced. From a security perspective, the site employs Google reCAPTCHA on its reservation form to mitigate spam and abuse. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is partial; a privacy policy is present but lacks a cookie consent mechanism, which is recommended for GDPR adherence. WHOIS data could not be retrieved due to query limits, limiting domain registration verification. Overall, Hotel Stelles presents a professional and trustworthy online presence suitable for its hospitality niche. Strategic improvements in privacy compliance and security headers would enhance its security posture and regulatory adherence.

100
60
75
72
17
10
70
hospitalityhoteleventspacegroupaccommodationlatvia+4 more
jQuery 3.7.0Google Analytics (gtag.js)Google Tag ManagerPhotoswipe+3
2025-07-30T16:00:25.972Z
J

Jēkabpils Rezidence

jekabpilsrezidence.lv

48
HospitalityLatviasmallHIGH

Jēkabpils Rezidence is a regional business and tourism development association focused on promoting tourism, historical sites, culture, and accommodation in Jēkabpils, Latvia. The website serves as an informational portal highlighting local attractions, nature tourism, and active recreation opportunities. It targets tourists and visitors interested in exploring the region's heritage and natural beauty. The business model centers on regional promotion rather than direct commercial sales. Technically, the website is built on WordPress with common plugins such as Yoast SEO and uses jQuery and Bootstrap for frontend functionality. The site is served over HTTPS with a valid SSL certificate, indicating a secure connection. The design is responsive and user-friendly, with good SEO optimization and basic accessibility features. However, there is room for improvement in security headers and privacy compliance. From a security perspective, the site lacks explicit security policies, privacy and cookie policies, and incident response information. No contact emails or phone numbers are provided, which limits transparency and user trust. The absence of security headers and vulnerability disclosure mechanisms suggests a moderate security posture. No vulnerabilities or suspicious content were detected in the HTML content. WHOIS data could not be retrieved due to query limits, but the site appears legitimate and professional. Overall, the website is functional and informative with a moderate security and privacy posture. Strategic improvements in privacy compliance, security headers, and contact transparency would enhance trust and compliance. The domain's legitimacy cannot be fully verified due to WHOIS data unavailability, but no red flags were observed in the content or technical setup.

75
60
100
75
-
-
-
tourismaccommodationhistoryculturenature+4 more
WordPressYoast SEO pluginjQueryBootstrap
2025-07-30T16:00:25.926Z
V

Villa Ventus

villaventus.com

47
HospitalityLatviasmallHIGH

Villa Ventus is a small hospitality business offering modern studio apartments for rent in the center of Liepaja, Latvia. The website provides comprehensive information about the villa, its facilities, house rules, and local attractions, targeting tourists and visitors seeking accommodation. The business appears to be well-positioned locally with a clear focus on quality and guest convenience, including pet-friendly options and flexible check-in/out. Technically, the website is built on WordPress with popular plugins such as WooCommerce, WPBakery Page Builder, and Contact Form 7. It uses HTTPS and has a cookie consent mechanism compliant with GDPR. The hosting provider is OVH sas, a reputable registrar and hosting company. The site shows good mobile optimization and SEO practices but lacks DNSSEC and some security headers, which could be improved. From a security perspective, the site has a good baseline with HTTPS and no exposed sensitive data detected. However, the absence of DNSSEC and security headers reduces its security posture slightly. No explicit security policies or incident response information are provided, which is common for small hospitality businesses but could be enhanced to build trust. Overall, Villa Ventus presents a professional and trustworthy online presence with good content quality and privacy compliance. Strategic improvements in security configurations and adding terms of service or security policies could further enhance credibility and protection.

20
85
2
70
42
75
-
hospitalitystudioapartmentsrentalliepajalatvia+3 more
WordPressWooCommerceWPBakery Page BuilderRevolution Slider+4
2025-07-30T16:00:25.259Z
grilltime.lv favicon

Grill Time

grilltime.lv

42
HospitalityLatviasmallHIGH

Grill Time is a small hospitality business operating a restaurant and event venue in Jūrmala, Latvia. The company specializes in grilled food prepared on a Josper grill using live fire, offering a unique culinary experience. They also provide banquet halls for events and celebrations, targeting local residents and tourists. The website presents clear business information, including contact details and service descriptions, positioning the company as a local dining and event destination. Technically, the website uses a standard technology stack including jQuery, Bootstrap, Owl Carousel, and Google Maps API. The site is moderately optimized for mobile devices and SEO, with good navigation and content quality. However, there is no evidence of advanced CMS or hosting details. Performance is moderate, with no major errors or broken elements detected. From a security perspective, the site uses HTTPS (implied by Google Maps API usage), but lacks visible security headers and privacy-related policies. No forms collecting sensitive data are present, reducing immediate risk. The absence of WHOIS data limits the ability to fully verify domain legitimacy. No tracking or analytics scripts were detected, indicating minimal user data collection. Overall, the website is functional and professional for its business purpose but would benefit from enhanced security practices, privacy compliance, and domain registration transparency to improve trust and compliance posture.

20
10
17
60
62
75
20
restauranthospitalityeventvenuegrilljrmala+1 more
jQueryBootstrap 3.3.7Owl CarouseljQuery Fancybox+2
2025-07-30T16:00:24.935Z
forestcamp.lv favicon

Forest Camp

forestcamp.lv

45
HospitalityLatviasmallHIGH

ForestCamp.lv operates a specialized summer camp focused on outdoor and touristic activities for children aged 7 to 17. The camp offers a variety of programs including camping skills, kayaking, laser tag, and night hikes, positioning itself as an established player with over 14 years of experience in the hospitality and recreational sector in Latvia. The website is primarily in Russian with Latvian language options, targeting local and regional families seeking summer camp experiences for their children. Technically, the website employs a modern JavaScript stack including jQuery, Slick Carousel, and fullPage.js, alongside Google Tag Manager and Analytics for tracking. The site is mobile-optimized with a clear navigation structure and cookie consent mechanisms, though accessibility features are basic. Performance is moderate with no critical technical issues detected. From a security perspective, the site uses HTTPS with good SSL configuration but lacks advanced security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were found in the HTML content. Privacy compliance is basic, with a privacy policy accessible but no terms of service or vulnerability disclosure information present. Overall, the website presents a trustworthy and professional front for a small hospitality business focused on children's summer camps. The lack of WHOIS data limits full domain legitimacy assessment, but the site content and contact information align with a legitimate operation. Recommendations include enhancing security headers, adding terms of service and incident response contacts, and improving accessibility and privacy compliance.

20
10
2
85
72
75
20
summercampchildrentourismoutdooractivitieslatvia+1 more
jQuerySlick CarouselfullPage.jsGoogle Tag Manager+2
2025-07-30T16:00:23.784Z
akurats.lv favicon

Akurāts

akurats.lv

51
HospitalityLatviamediumMEDIUM

Akurāts is a well-established Latvian company specializing in the rental of tents, tables, chairs, floors, heaters, and other event equipment. Founded in 2005, it holds a leading market position in Latvia and the Baltic region, serving a diverse clientele including event organizers, businesses, and private individuals. The website reflects a professional and consistent brand image, offering comprehensive services with clear contact channels and client testimonials that enhance trust. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Maps API, and Google reCAPTCHA for form security. Hosting and domain registration are managed via reputable providers (GoDaddy and Cloudflare DNS). The site is mobile-optimized and SEO-friendly, though performance is moderate. Cookie consent is implemented, but explicit privacy and terms of service pages are missing. Security posture is generally good with HTTPS and reCAPTCHA, but lacks advanced DNS security (DNSSEC) and explicit security policies or incident response information. No critical vulnerabilities were detected, but improvements are recommended in security headers and transparency. Overall, the website and business present a low-risk profile with strong business credibility and moderate technical maturity. Strategic enhancements in privacy compliance and security transparency would further strengthen trust and compliance.

15
35
17
70
72
75
40
eventequipmenttentrentaltablerentalchairrentallatvia+2 more
WordPressPHPjQueryGoogle Maps API+6

Partner Domains:

ramirent.com
partner
losberger.com
partner

+3 more partners

2025-07-30T16:00:23.323Z
stayliepaja.lv favicon

Stayliepaja.lv

stayliepaja.lv

46
HospitalityLatviasmallHIGH

Stayliepaja.lv is a small hospitality business offering guest house accommodations near the picturesque white sandy beaches of Liepāja, Latvia. The website presents two main guest houses located on Palangas street, targeting families and groups of friends seeking comfortable stays close to the sea and city amenities. The business model focuses on direct bookings via their website and through partners such as Booking.com and Airbnb.com. The site supports multiple languages, enhancing accessibility for international tourists. Technically, the website is built on WordPress using the Divi theme and Yoast SEO plugin, indicating a modern and manageable infrastructure. The site loads with moderate performance and is mobile-optimized, providing a good user experience. However, some improvements in accessibility and advanced SEO could be considered. From a security perspective, the site uses HTTPS and basic security headers but lacks advanced headers and a cookie consent mechanism, which are important for GDPR compliance. No WHOIS data was available due to query limits, but the website content and contact information suggest a legitimate and transparent business. There are no visible vulnerabilities or exposed sensitive data. Overall, the website is functional, professional, and trustworthy for its business purpose. Strategic improvements in privacy compliance and security headers would enhance its security posture and regulatory adherence.

30
10
17
55
95
85
-
hospitalityguesthouseliepjalatviavacationrental+3 more
WordPressDivi ThemeYoast SEOjQuery+1
2025-07-30T16:00:23.283Z
sensoryroomforest.lv favicon

Bērnu istaba - Forest | Bērnu Ballītes

sensoryroomforest.lv

44
HospitalityLatviasmallHIGH

The website sensoryroomforest.lv represents a small local business offering a sensory room and event space primarily for children's parties and developmental activities in Jūrmala, Latvia. The business provides a unique themed environment with various attractions and animator-led programs, targeting parents seeking a safe and engaging venue for their children. The site content is well-structured, visually appealing, and includes customer testimonials and clear contact information, supporting a trustworthy user experience. Technically, the website employs modern frontend technologies such as Bootstrap 4.6, jQuery, FontAwesome, and Slick Carousel, alongside Google Tag Manager and Facebook Pixel for analytics and marketing. The site is mobile-optimized and SEO-friendly but lacks advanced accessibility features and explicit security headers, which could be improved to enhance security posture. Security-wise, the site uses HTTPS and form validation but does not display HTTP security headers like CSP or HSTS, nor does it have visible anti-CSRF protections. Privacy and cookie policies are present but lack explicit consent mechanisms, indicating partial GDPR compliance. No WHOIS data was available due to query limits, but the website content and contact details suggest a legitimate small business with no suspicious indicators. Overall, the website is functional, professional, and suitable for its target audience, with moderate security and privacy compliance. Strategic improvements in security headers, consent management, and transparency would strengthen its risk profile and user trust.

15
10
2
85
72
75
20
childrenpartysensoryroomeventslatvia+2 more
Bootstrap 4.6jQueryFontAwesome 5.8Slick Carousel+4
2025-07-30T16:00:22.950Z
playroom.lv favicon

PlayRoom.lv

playroom.lv

56
HospitalityLatviasmallMEDIUM

PlayRoom.lv is a Latvian online platform specializing in listing and promoting venues suitable for children's and family celebrations and events. The website offers a categorized directory of venues such as playrooms, kids cafes, laser tag arenas, quest rooms, and more, targeting parents and families in Latvia. It provides search and filtering capabilities by location and category, along with user account features for login and listing submissions. The platform positions itself as a niche local leader in the hospitality sector focused on family entertainment. Technically, the website is built on WordPress CMS with WooCommerce and WPBakery Page Builder, integrating Google Analytics and Google Tag Manager for analytics and Google AdSense for advertising. The site is mobile-optimized with a moderate performance profile and includes basic accessibility features. Security best practices such as HTTPS enforcement, security headers, and GDPR cookie consent are implemented, though no explicit security or incident response policies are published. The security posture is generally good with no visible vulnerabilities or exposed sensitive data. Privacy compliance is supported by a privacy policy and cookie consent mechanism. However, WHOIS data could not be retrieved due to query limits, limiting the ability to fully verify domain registration legitimacy. Overall, the site appears professional, trustworthy, and well-maintained, serving a clear business purpose in the Latvian market. Strategic recommendations include publishing a formal security policy, adding incident response contact details, considering a vulnerability disclosure program, enhancing accessibility, and regularly auditing third-party scripts to maintain security and compliance.

15
100
17
70
72
75
20
childrenpartyvenueslatviaeventlistingsfamily+4 more
WordPressWooCommerceWPBakery Page BuilderGoogle Analytics+6
2025-07-30T16:00:22.703Z
sialats.lv favicon

sia "Lats"

sialats.lv

42
HospitalityLatviasmallHIGH

The website sialats.lv represents a small hospitality business named sia "Lats" operating the cafe “Zem liepas” in Grobiņa, Latvia. The business focuses on food services including catering for weddings, festive events, funerals, and providing a menu for onsite and takeaway dining. The site is built on WordPress and uses common plugins for photo galleries and social sharing. Contact information including phone numbers, email, and physical address is clearly presented, supporting business credibility. However, the site lacks formal privacy, cookie, and terms of service policies, which are important for compliance and user trust. Technically, the website uses HTTPS and modern web technologies such as jQuery and Font Awesome, but it lacks security headers that could enhance protection against common web threats. The site appears to be moderately optimized for mobile and SEO, with a good user experience and clear navigation. No advanced analytics or tracking services are detected, indicating minimal user tracking. Security posture is basic but adequate for a small local business, with no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data due to query limits limits the ability to fully verify domain legitimacy, but the website content and business information appear consistent and trustworthy. Overall, the site is functional and professional but would benefit from enhanced security and privacy compliance measures. Recommendations include implementing security headers, publishing privacy and cookie policies, and adding vulnerability disclosure and incident response information to improve trust and compliance.

15
10
17
70
62
75
20
hospitalitycateringfoodeventslocalbusiness+1 more
WordPress 6.8.2jQueryAddToAny sharing pluginPhoto Gallery plugin+2
2025-07-30T16:00:22.519Z