Skip to main content

United States security reports

Browse 10,264 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 40 of 206|Showing 1951-2000 of 10264
githubnext.com favicon

GitHub, Inc.

githubnext.com

0
TechnologyUnited StatesenterpriseMEDIUM

GitHub Next is a research and engineering team within GitHub, focusing on exploring the future of software development through prototyping innovative tools and technologies. Their work targets software developers and engineering teams, aiming to improve productivity and collaboration using AI and other advanced technologies. The website reflects a professional and enterprise-grade digital presence consistent with GitHub's brand and market position. Technically, the site is built using modern web technologies including Next.js and React, ensuring good performance, mobile optimization, and accessibility. The infrastructure appears robust with reputable DNS and hosting providers. However, some standard security practices like DNSSEC are not enabled, and security headers information is not available from the data. From a security perspective, the site uses HTTPS and domain registration protections, but lacks visible security policies, incident response contacts, and vulnerability disclosure mechanisms. Privacy and cookie policies are also absent, which may impact compliance with regulations like GDPR. No contact emails or phone numbers are provided, which limits direct communication channels. Overall, the website is trustworthy and professional but could improve in privacy compliance and security transparency. Strategic recommendations include publishing privacy and cookie policies, enabling DNSSEC, adding security headers, and providing clear contact and incident response information.

50
35
47
70
82
80
100
technologysoftwaredevelopmentresearchaigithub+1 more
ReactNext.jsJavaScriptCSS+2
2025-10-12T17:51:06.835Z
fireflies.ai favicon

Digital Privacy Corporation

fireflies.ai

0
TechnologyUnited StatesmediumMEDIUM

Fireflies.ai is a technology company specializing in AI-powered meeting transcription, summarization, and conversation intelligence. Founded in 2017 and operated by Digital Privacy Corporation in the United States, it offers a SaaS platform that integrates with popular meeting and productivity tools to enhance team collaboration and productivity. The company positions itself as an industry leader with a strong market presence, serving over 500,000 companies globally. Their key services include high-accuracy transcription, multi-language support, speaker recognition, AI summaries, and integrations with CRM, project management, and communication platforms. Technically, the website is built on modern frameworks such as Next.js and leverages Cloudflare for DNS and CDN services. It employs multiple analytics and marketing tools including Heap Analytics, Google Tag Manager, Facebook Pixel, and ProfitWell, indicating a mature digital marketing and data collection strategy. The site is well-optimized for performance, mobile responsiveness, and SEO, providing an excellent user experience. From a security perspective, the site uses HTTPS with a clientTransferProhibited domain status, indicating domain transfer protection. It holds GDPR and SOC2 certifications, signaling compliance with key data protection standards. However, DNSSEC is not enabled, and no explicit security.txt or vulnerability disclosure pages were found. No direct contact emails or phone numbers are publicly listed, which may impact user trust and support accessibility. Overall, Fireflies.ai presents a professional, secure, and compliant online presence with strong business credibility and technical maturity. Strategic recommendations include enabling DNSSEC, publishing a security policy or vulnerability disclosure, and providing clearer contact information to enhance trust and compliance further.

50
65
47
80
75
80
100
aimeetingtranscriptionproductivitysaastechnology+1 more
React (Next.js)Cloudflare DNSHeap AnalyticsGoogle Tag Manager+6
2025-10-12T17:49:36.562Z
pillar.io favicon

Domains By Proxy, LLC

pillar.io

0
TechnologyUnited StatesmediumMEDIUM

Pillar.io is a SaaS platform focused on empowering social media creators, coaches, and digital marketers by providing an all-in-one link in bio tool that enables users to create, host, and sell digital products and services. The platform integrates marketing tools, AI assistants, and e-commerce capabilities to automate creator business operations and facilitate brand deals. With a user base exceeding 100,000 creators, Pillar positions itself as a comprehensive solution in the creator economy space. Technically, the website leverages modern web technologies including Webflow CMS, Google Tag Manager, TikTok and Facebook Pixels, PostHog analytics, and personalization tools like Intellimize. Hosting appears to be on AWS infrastructure with GoDaddy as the domain registrar. The site is mobile optimized and demonstrates good SEO and accessibility practices, though some accessibility features are basic. From a security perspective, the website enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, DNSSEC is not enabled, and no explicit security headers or policies are published. The site lacks visible privacy and cookie policies, which impacts privacy compliance scores. No vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, Pillar.io presents a professional and functional platform with moderate security and privacy compliance maturity. Strategic improvements in privacy disclosures, security headers, and DNS security would enhance trust and compliance.

30
53
2
55
67
80
100
creatortoolslinkinbioe-commercemarketingsaas+3 more
Webflow CMSGoogle Tag ManagerTikTok PixelFacebook Pixel+3
2025-10-12T17:48:25.580Z
stell-engineering.com favicon

Stell

stell-engineering.com

0
TechnologyUnited StatessmallMEDIUM

Stell is a US-based technology company specializing in secure requirements management software tailored for mission-critical and highly regulated industries such as aerospace and defense. Their platform transforms complex technical documentation into actionable workflows, emphasizing collaboration, compliance, and security. The company highlights its adherence to stringent government security standards including SOC 2 Type 2 certification, NIST 800-171 compliance, and holds an IL5 ATO under U.S. Space Force sponsorship, underscoring its commitment to security and trustworthiness. Technically, Stell's website is built on the Squarespace platform, leveraging modern web technologies including JavaScript, Typekit fonts, and embedded video players. The site is well-optimized for mobile devices and demonstrates good SEO and accessibility practices, though some improvements are possible. The security posture is strong with HTTPS enforced and HSTS enabled, and no obvious vulnerabilities detected in the site content or scripts. However, the WHOIS data for the domain is missing or unavailable, which raises concerns about domain registration legitimacy. Additionally, the site lacks explicit privacy and cookie policies, as well as direct contact information, which are important for compliance and user trust. Marketing and analytics tools such as Google Tag Manager and LinkedIn Insight are used, indicating moderate user tracking. Overall, Stell presents as a professional and secure SaaS provider in a niche market, but should address privacy compliance gaps and verify domain registration details to enhance trust and regulatory adherence.

45
53
47
80
62
85
100
requirementsmanagementaerospacedefensesoftwaresecure+5 more
Squarespace CMSJavaScriptTypekit fontsGoogle Tag Manager+1
2025-10-12T17:47:48.888Z
nutrisense.io favicon

Nutrisense

nutrisense.io

0
HealthcareUnited StatesmediumMEDIUM

Nutrisense is a healthcare-focused company specializing in personalized metabolic health insights through continuous glucose monitoring (CGM) technology combined with expert dietitian coaching. The company targets individuals seeking sustainable health improvements such as weight loss, energy enhancement, and better metabolic control. Their business model is subscription-based, offering CGM sensor deliveries and 1:1 coaching, with some services covered by insurance. The website reflects a mature digital presence with a strong brand, extensive member testimonials, and trust signals like high Trustpilot ratings. Technically, the website leverages modern web technologies including React, Webflow CMS, and AWS Cloudfront for hosting and content delivery. It integrates multiple marketing and analytics tools such as Klaviyo, TikTok Pixel, Facebook Pixel, Microsoft Clarity, and Google Tag Manager, indicating a sophisticated approach to user engagement and data-driven marketing. The site is well-optimized for mobile and accessibility, with fast performance and good SEO practices. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR. While explicit security headers are not fully confirmed in the provided data, the use of reputable third-party services and absence of exposed sensitive data suggest a solid security posture. However, the lack of publicly available incident response or security policy documents is a gap. The WHOIS data is unavailable due to a malformed request, limiting domain trust verification, but the overall site professionalism and branding support legitimacy. Overall, Nutrisense presents a trustworthy and professional online presence with strong business credibility and technical maturity. Strategic recommendations include enhancing public security disclosures, verifying and publishing security headers, and improving WHOIS transparency to bolster domain trust.

60
68
17
85
75
85
100
healthcareglucosemonitoringnutritioncoachingpersonalizedhealth+3 more
React (implied by bundle naming and module usage)Cloudfront CDNKlaviyo (marketing and analytics)TikTok Pixel+8
2025-10-12T17:47:38.870Z
estewartandassociates.com favicon

E. Stewart & Associates

estewartandassociates.com

0
OtherUnited StatessmallHIGH

E. Stewart & Associates is a specialized fire prevention company operating primarily in Southern California, with over 30 years of experience. The company offers a range of environmental and fire prevention services including weed abatement, brush clearing, native habitat restoration, erosion control, and trail maintenance. Their clientele includes multiple municipalities, indicating a strong regional presence and trusted service provider status. The website reflects a professional and consistent brand image with clear contact information and service descriptions. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Flickity carousel, GSAP animations, and Vimeo for media integration. It is hosted by DreamHost, LLC, and uses HTTPS with a valid SSL certificate, ensuring secure communications. The site is moderately optimized for performance and mobile responsiveness, with good SEO practices evident in meta tags and structured data. From a security perspective, the site has a solid foundation with HTTPS and domain transfer protections but lacks advanced security headers and DNSSEC. There is no visible privacy policy or cookie consent mechanism, which presents compliance risks, especially under GDPR. No incident response or vulnerability disclosure information is provided, limiting transparency in security practices. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security hardening to reduce risk and improve user trust. Strategic improvements in these areas would elevate the site's security posture and regulatory adherence.

15
50
17
40
-
75
20
firepreventionweedabatementbrushclearingcaliforniaenvironmentalservices+1 more
WordPressPHPjQueryFlickity carousel+3
2025-10-12T16:42:09.064Z
yinger.dev favicon

Max Yinger

yinger.dev

0
TechnologyUnited StatessmallMEDIUM

The website yinger.dev is a personal professional portfolio for Max Yinger, a UI Engineer specializing in realtime 3D, interaction, and performance. The site showcases his skills and professional presence with links to GitHub, LinkedIn, Twitter, and YouTube. The business model is a personal portfolio aimed at technology professionals and UI/UX developers. The site is hosted on Vercel using a modern React and Next.js stack, delivering fast performance and good mobile optimization. However, it lacks formal privacy, cookie, and security policies, which are important for compliance and trust. From a security perspective, the site uses HTTPS with excellent SSL configuration and no visible vulnerabilities or exposed sensitive data. Security headers are not explicitly detected, and there is no published security or incident response policy. Analytics usage is minimal and handled via Vercel's own tools, with no aggressive tracking or advertising detected. The site content is safe for general audiences with no adult or questionable content. Overall, the website scores well on technical implementation and business credibility but scores low on privacy compliance due to missing policies. The domain WHOIS data is consistent with the website content and owner identity, indicating legitimacy. Strategic recommendations include adding privacy and cookie policies, implementing security headers, and publishing a vulnerability disclosure or security.txt file to enhance trust and compliance.

30
35
2
40
72
80
100
uiengineerrealtime3dperformanceportfolioreact+2 more
ReactNext.jsVercel AnalyticsVercel Speed Insights
2025-10-12T16:41:54.010Z
lindywealth.com favicon

Lindy Wealth LLC

lindywealth.com

0
FinanceUnited StatessmallMEDIUM

Lindy Wealth LLC is a small finance sector company specializing in flat-fee financial planning and wealth management services tailored for content creators, YouTubers, and online entrepreneurs. The business is positioned as a niche provider focusing on tax strategy, fee minimization, and diversified investing, targeting solopreneurs in the United States. The website content and structured data confirm a professional approach with a Certified Financial Planner (CFP®) leading the services. The domain registration is recent (2025) and consistent with the business claims, indicating a legitimate startup operation. Technically, the website is built using modern web technologies including the Remix framework, with a focus on responsive design and good user experience. However, the site lacks visible security headers and DNSSEC is not enabled, which are areas for improvement. No analytics or tracking scripts were detected, suggesting minimal user tracking. The site does not currently provide privacy or cookie policies, which is a compliance gap especially for GDPR considerations. From a security perspective, the site uses HTTPS (implied by the domain and modern setup), but lacks explicit security headers and incident response contact information. No forms or input fields were detected in the provided HTML snapshot, reducing immediate attack surface but also limiting user interaction. The absence of privacy and cookie policies and limited contact information reduce trust and compliance posture. Overall, the security posture is moderate but could be significantly improved with standard best practices. The overall risk assessment is moderate with no critical vulnerabilities detected but notable compliance and security policy gaps. Strategic recommendations include implementing privacy and cookie policies, enabling DNSSEC, adding security headers, and providing clear contact information for security incidents. These steps will enhance trust, compliance, and security maturity for Lindy Wealth.

30
35
2
60
52
80
100
financialplanningwealthmanagementtaxstrategycontentcreatorssolopreneurs+1 more
JavaScriptCSSHTML
2025-10-12T16:37:17.834Z
rmkinjurylaw.com favicon

The Law Office of Richard M. Kenny

rmkinjurylaw.com

0
OtherUnited StatessmallMEDIUM

The Law Office of Richard M. Kenny is a small, highly specialized personal injury law firm based in New York City, serving clients across multiple boroughs including Manhattan, Bronx, Brooklyn, Queens, and Nassau County. The firm emphasizes a client-focused approach with a strong track record of over $500 million recovered and more than 5,000 cases prepared for trial. Their services cover a broad range of personal injury and medical malpractice claims, positioning them as a top-rated legal service provider in the NYC market. Technically, the website is built on WordPress with modern plugins such as Gravity Forms for client intake and Yoast SEO for search optimization. The site demonstrates good mobile responsiveness, accessibility, and SEO practices. Security is well implemented with HTTPS and multiple security headers, though the absence of a visible cookie consent mechanism suggests room for improvement in privacy compliance. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to privacy protection slightly reduces transparency but is common for legal firms. Overall, the site is professional, trustworthy, and well-maintained, supporting the firm's market position. Strategically, the firm should enhance privacy compliance by implementing a cookie consent banner and consider publishing explicit security and incident response policies to further build client trust and meet regulatory requirements.

65
68
17
75
75
75
100
personalinjurylawyernyclegalservicesmedicalmalpractice+2 more
WordPressGravity FormsjQueryOwl Carousel+3
2025-10-12T15:34:51.341Z
martinezlawhouston.com favicon

The Martinez Law Firm - Houston DWI Lawyer

martinezlawhouston.com

0
OtherUnited StatessmallMEDIUM

The Martinez Law Firm is a specialized legal practice based in Houston, Texas, focusing on criminal defense and DWI cases. Led by attorney Herman Martinez, the firm boasts over 25 years of experience and a strong reputation in the Houston legal market. The firm targets individuals facing criminal charges in Houston and Harris County, offering personalized and client-driven legal services. Their market position is reinforced by numerous client testimonials, awards, and a high aggregate rating, positioning them as a trusted choice for criminal defense in the region. Technically, the website is built on WordPress using WPBakery Page Builder and NitroPack for performance optimization. It employs modern web technologies and is well-optimized for SEO and mobile devices, providing a fast and user-friendly experience. Security-wise, the site uses HTTPS with good SSL configuration but lacks some security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. WHOIS data is incomplete or unavailable, which slightly reduces domain trustworthiness, but the professional website and business signals mitigate this concern. Overall, the site demonstrates strong business credibility and technical maturity with room for improvement in privacy and security transparency.

15
58
2
70
52
75
100
lawyercriminaldefensedwihoustonlegalservices+1 more
WordPressWPBakery Page BuilderNitroPackGoogle Tag Manager+2
2025-10-12T15:34:06.226Z
egochi.com favicon

Egochi Digital Marketing Agency

egochi.com

0
TechnologyUnited StatesmediumMEDIUM

Egochi Digital Marketing Agency is a professional, award-winning digital marketing firm specializing in SEO, PPC, content marketing, social media marketing, web design, and online reputation management. The company positions itself as a data-driven, client-focused agency delivering measurable results and sustainable growth for businesses. Their market presence is supported by multiple certifications and strong client testimonials, indicating a reputable and established business. Technically, the website is built on WordPress with modern plugins and tools such as Yoast SEO, Google Analytics, and Contact Form 7. The site is well-structured, mobile-optimized, and uses HTTPS, but lacks some advanced security headers and explicit privacy/cookie policies. The contact form includes CAPTCHA to mitigate spam. Security posture is generally good with HTTPS and no visible vulnerabilities, but the absence of security headers and a published security policy reduces the overall security maturity. The missing WHOIS registration data is a notable anomaly that requires further investigation to confirm domain legitimacy. Overall, the website is professional and trustworthy from a business and content perspective, but improvements in privacy compliance and security best practices are recommended to enhance trust and regulatory adherence.

20
53
17
75
75
75
100
digitalmarketingseoppccontentmarketingsocialmedia+4 more
WordPress CMSYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+5
2025-10-12T15:33:56.176Z
davidhardawaylaw.com favicon

The Law Offices of David C. Hardaway

davidhardawaylaw.com

0
OtherUnited StatessmallHIGH

The Law Offices of David C. Hardaway is a specialized criminal defense law firm based in San Marcos, Texas, serving clients primarily in Hays County and surrounding Central Texas areas. The firm offers comprehensive legal defense services including DWI, drug crimes, violent crimes, and other serious criminal charges. The website is professionally designed with rich content, detailed FAQs, attorney profiles, case results, and client testimonials, positioning the firm as a reputable and trusted legal service provider in the region. The firm holds multiple industry recognitions and certifications, enhancing its market credibility. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Swiper.js, and uses Google Fonts and Google Tag Manager for analytics and tracking. The site employs HTTPS with good SSL configuration and includes spam protection via Google reCAPTCHA on its contact form. However, it lacks visible security headers and cookie consent mechanisms, which are recommended for improved security and privacy compliance. From a security perspective, the site shows good practices like HTTPS enforcement and no exposed sensitive data, but the absence of WHOIS data for the domain raises concerns about domain registration legitimacy. Despite this, the website content and structure strongly indicate a legitimate business operation. Overall, the site scores well on content quality, business credibility, and technical implementation but should address privacy compliance and security header improvements. Strategically, the firm should verify domain registration details, implement comprehensive privacy and cookie policies with consent mechanisms, and enhance security headers to strengthen trust and compliance. These improvements will support the firm's professional image and reduce potential risks related to privacy and security.

15
53
17
70
72
75
-
lawfirmcriminaldefensedwilawyersanmarcostexas+4 more
WordPressjQuerySwiper.jsGoogle Fonts+5

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:46.044Z
farmerclinecampbell.com favicon

Farmer, Cline & Campbell Personal Injury Lawyers

farmerclinecampbell.com

0
OtherUnited StatesmediumMEDIUM

Farmer, Cline & Campbell Personal Injury Lawyers is a well-established personal injury law firm based in Charleston, West Virginia, with nearly 30 years of experience and over 300 years of combined attorney experience. The firm specializes in a wide range of personal injury cases including vehicle accidents, catastrophic injuries, and wrongful death. They have a strong market position supported by numerous legal awards, certifications, and a large volume of positive client reviews. Their business model focuses on providing expert legal representation to injured individuals in West Virginia, offering free consultations and emphasizing client trust and success. Technically, the website is built on WordPress with modern performance optimizations such as NitroPack, and integrates popular tools like Gravity Forms and Google Analytics. The site is mobile-optimized, fast-loading, and professionally designed, providing an excellent user experience. Security posture is good with HTTPS and reCAPTCHA protections, though it lacks some advanced security headers and DNSSEC. Privacy compliance is limited due to the absence of explicit privacy and cookie policies. Overall, the website reflects a credible and professional legal service provider with strong business credibility but could improve privacy transparency and security hardening.

15
53
17
40
52
75
100
personalinjurylawyerlegalserviceswestvirginiacharleston+5 more
WordPressGravity FormsNitroPackGoogle Fonts+4
2025-10-12T15:33:41.008Z
fanninglawllc.com favicon

Fanning Law, LLC

fanninglawllc.com

0
OtherUnited StatessmallMEDIUM

Fanning Law, LLC is a well-established small law firm specializing in family law services in Southern Maryland, particularly La Plata and Charles County. Led by attorney William C. Fanning Jr., the firm offers comprehensive legal assistance in divorce, child custody, support, property division, and related family law matters, with additional practice areas in personal injury, criminal defense, and business law. The website reflects a professional and client-focused approach with detailed content, testimonials, and local expertise. Technically, the website is built on WordPress with modern libraries such as jQuery and Swiper, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized, accessible, and performs moderately well. Security measures include HTTPS and Google reCAPTCHA on forms, though security headers are not detected, and privacy compliance could be improved with explicit policies and cookie consent mechanisms. The security posture is solid with no visible vulnerabilities or exposed sensitive data, but the absence of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. However, the professional presentation and detailed business information mitigate these concerns. Overall, the site is trustworthy and serves its target audience effectively. Recommendations include enhancing privacy and cookie policies, implementing security headers, publishing incident response contacts, and regular security audits to maintain compliance and trust.

55
53
17
75
72
75
-
familylawdivorcelegalservicesmarylandlawyer+3 more
WordPressjQuery 3.7.1Swiper 6.5.4Google Fonts+2

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:20.723Z
mrlevelhead.com favicon

Mr. Level Head

mrlevelhead.com

0
OtherUnited StatessmallHIGH

Mr. Level Head is a small, local handyman and home repair service provider based in Spring Hill, Florida, serving Hernando and Pasco counties. The company offers a wide range of home repair services including door repair, electrical work, painting, drywall repair, furniture assembly, plumbing, and more. The website positions the business as reliable and detail-oriented, supported by multiple positive customer testimonials and local business listings such as BBB and Yelp. The business model is straightforward, charging by the job with flexible scheduling and a one-year labor warranty, targeting homeowners and residents in the local area. Technically, the website is built on WordPress using the Elementor page builder and related plugins, leveraging modern web technologies such as jQuery, Font Awesome, and Google Fonts. The site is hosted likely via GoDaddy, with a moderate performance profile and good mobile optimization. SEO is well addressed with proper meta tags, structured data (JSON-LD), and clear navigation. However, accessibility is basic and could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and DNSSEC. No privacy or cookie policies are present, indicating compliance gaps especially regarding GDPR. There is no visible incident response or vulnerability disclosure information. Analytics and tracking are implemented via Google Analytics, Ahrefs, and StatCounter, with moderate user tracking levels but limited privacy transparency. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and clearer policies to strengthen user trust and regulatory adherence.

15
35
17
55
72
80
40
handymanhomerepairlocalbusinessspringhillflhomeservices+1 more
WordPressElementorElementor ProjQuery+3
2025-10-12T15:32:50.656Z
polar.sh favicon

Polar Software Inc.

polar.sh

0
TechnologyUnited StatessmallMEDIUM

Polar Software Inc. is a technology startup founded in 2022, providing modern payment infrastructure solutions tailored for the 21st century. Their platform offers comprehensive services including payments, usage and billing, customer management, and global merchant of record capabilities. Positioned as a developer-friendly SaaS solution, Polar targets software creators and SaaS companies seeking seamless monetization and compliance with tax regulations. The company has secured a $10M seed round and maintains an open source presence, enhancing its credibility and community engagement. Technically, Polar leverages modern web technologies such as React and Next.js, hosted likely on cloud platforms with Cloudflare DNS services. The website demonstrates excellent performance, mobile optimization, and SEO practices. Integration with Google Analytics and Stripe Connect indicates a mature digital infrastructure supporting analytics and payment processing. From a security perspective, the site enforces HTTPS and employs domain transfer protection. However, DNSSEC is not enabled, and explicit security headers are not clearly visible. The absence of a published security policy or incident response contact suggests room for improvement in transparency and readiness. No vulnerabilities or exposed sensitive data were detected in the analysis. Overall, Polar presents a professional, trustworthy online presence with strong business and technical foundations. Strategic recommendations include enhancing security headers, enabling DNSSEC, publishing security policies, and establishing a vulnerability disclosure program to further strengthen trust and compliance.

70
68
2
85
72
80
100
paymentsaasmerchantofrecordbillingsubscriptions+3 more
ReactNext.jsCloudflare DNSGoogle Analytics+1
2025-10-12T15:31:43.383Z