Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 91 of 3147|Showing 4501-4550 of 157326
C

Security Verification

chelburn.co.uk

48
OtherN/asmallHIGH

The website www.chelburn.co.uk currently serves only a security verification page implementing Google reCAPTCHA v3 to prevent automated access. The domain WHOIS lookup failed due to the domain name violating Nominet UK naming rules, indicating the domain is invalid or misconfigured. No business, contact, or policy information is available on the site, severely limiting the ability to assess the company's operations or legitimacy. Technically, the site uses Bootstrap 5.3.3 and Google reCAPTCHA but lacks visible HTTPS enforcement and security headers. The site is effectively blocked behind a bot verification mechanism, restricting content access and analysis. From a technical infrastructure perspective, the site is minimal and lacks modern security best practices such as security headers and published privacy or cookie policies. The absence of contact information and business details further reduces trust and credibility. The domain's invalid status in WHOIS records raises significant concerns about legitimacy. Security posture is weak due to missing HTTPS enforcement, lack of security headers, and no visible compliance with privacy regulations such as GDPR. The use of Google reCAPTCHA is a positive security measure but insufficient to compensate for other deficiencies. Overall, the site presents a high risk profile due to domain registration issues and minimal accessible content. Strategically, the site requires urgent remediation to establish valid domain registration, implement HTTPS, publish privacy and cookie policies, and provide clear business and contact information to improve trust and compliance. Until these issues are addressed, the site remains low trust and inaccessible to normal users.

70
100
65
57
50
2
15
securityverificationcaptchabotprotection
Bootstrap 5.3.3Google reCAPTCHA v3
2026-07-12T07:19:22.252Z
vola.com favicon

VOLA

vola.com

61
ManufacturingDenmarkmediumMEDIUM

VOLA is a Danish manufacturing company specializing in taps and accessories characterized by timeless Scandinavian design and exceptional craftsmanship since 1968. The company positions itself as a premium brand with a strong heritage, targeting architects, designers, and discerning consumers worldwide. Their business model emphasizes made-to-order production, customization, and a modular product system, supported by a global dealer and specialist network. Technically, the website employs modern web technologies including AngularJS, Google Tag Manager, and Cookiebot for consent management, hosted likely behind Cloudflare, ensuring good performance and mobile optimization. Security posture is strong with HTTPS enforcement, CSRF protection, and cookie consent mechanisms, though explicit security policies and incident response contacts are not publicly available. Privacy compliance is well addressed with a comprehensive GDPR-aligned privacy policy and cookie consent banner. The absence of WHOIS data for the domain limits full trust verification, but the website's professional presentation and external social media presence support legitimacy. Overall, the site demonstrates a mature digital presence with room for improvement in transparency of security and contact information.

65
27
100
70
95
17
35
scandinaviandesigntapsaccessoriesdanishcraftsmanshipprivacypolicy+4 more
AngularJS (ng-app, ng-scope)Google Tag ManagerCookiebot for consent managementSwiper.js for sliders+3
2026-07-12T07:18:54.947Z
A

A Wardle & Co (Casters) Ltd.

awardle.co.uk

57
ManufacturingUnited KingdomsmallMEDIUM

A Wardle & Co (Casters) Ltd. is an independent manufacturer specializing in lost wax casting, located in the Birmingham Jewellery Quarter, UK. The company targets jewellery manufacturers and designers, offering specialized manufacturing services. The website reflects a professional and consistent brand image with clear contact information and a user-friendly interface. However, the WHOIS data for the queried domain www.awardle.co.uk is unavailable due to domain naming rules violations, indicating the actual domain in use is likely awardle.co.uk, which aligns with the company's email and contact details. Technically, the website employs modern JavaScript libraries such as Barba.js and AOS for smooth page transitions and animations, with a responsive design optimized for mobile devices. The site lacks visible security headers and privacy policies, which are critical for compliance and security posture. The contact form collects personal data with a GDPR opt-in checkbox but does not link to a privacy or cookie policy, representing a compliance gap. From a security perspective, the site uses HTTPS (assumed from the URL), but no explicit security headers were detected in the HTML content. There are no signs of WAF or blocking mechanisms, and no analytics or tracking scripts were found, indicating minimal user tracking. The absence of privacy and cookie policies and security headers lowers the overall security and privacy compliance scores. Overall, the website is functional, professional, and relevant to its manufacturing niche but requires improvements in security headers, privacy compliance, and WHOIS domain consistency to enhance trust and reduce risk.

69
70
100
70
30
2
50
manufacturinglostwaxcastingjewellerybirminghamindependentmanufacturer
HTML5CSS3JavaScript
2026-07-12T07:18:38.327Z
sait-abrasives.co.uk favicon

SAIT Abrasives (UK) Ltd

sait-abrasives.co.uk

47
ManufacturingUnited KingdommediumHIGH

SAIT Abrasives (UK) Ltd is a well-established industrial manufacturer specializing in coated and bonded abrasives, serving the UK and European markets. Founded in 1953 as part of the larger SAIT Abrasivi S.p.A., the company offers a comprehensive product catalog and technical support services, positioning itself as a leader in the abrasives industry. The website reflects a professional B2B business model targeting industrial customers across multiple sectors including metal, wood, building materials, and automotive. Technically, the website is built on the PrestaShop CMS platform, utilizing modern JavaScript libraries and tracking tools such as Google Analytics and Hotjar. It is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security-wise, the site enforces HTTPS and uses secure forms but lacks some recommended security headers and incident response disclosures. Privacy and cookie policies are present with consent mechanisms, indicating basic GDPR compliance. WHOIS data could not be retrieved due to a domain query error, but the website content and contact information strongly suggest legitimacy. Overall, the site demonstrates a solid digital presence with room for security and compliance enhancements.

70
65
52
20
68
2
20
abrasivesmanufacturingindustrialcoatedabrasivesbondedabrasives+2 more
jQueryGoogle AnalyticsGoogle Tag ManagerHotjar+4
2026-07-12T07:18:32.941Z
R

Security Verification

roberts-wales.co.uk

51
OtherN/asmallMEDIUM

The website www.roberts-wales.co.uk is currently inaccessible beyond a security verification page that employs Google reCAPTCHA v3 to block automated access. No actual business content, contact information, or policies are available on the page, indicating that the site is either under protection by a Web Application Firewall (WAF) or is misconfigured. The WHOIS lookup for the domain failed with an error from Nominet UK stating the domain name contravenes naming rules and cannot be registered, suggesting the domain is invalid or improperly set up. This severely limits the ability to analyze the website's business or security posture comprehensively. From a technical perspective, the site uses Bootstrap 5.3.3 and Google reCAPTCHA v3, but no other technologies, CMS, or hosting details are discernible. Security headers and HTTPS enforcement are not visible in the provided data, and no privacy or cookie policies are present. The lack of contact information and business details further reduces trustworthiness and credibility. The security posture is weak due to the absence of visible HTTPS, security headers, and transparency about data protection or incident response. The domain's invalid registration status and the presence of a blocking security verification page indicate a high risk and low legitimacy. Overall, the site scores very low on content quality, technical implementation, security, privacy compliance, and business credibility. Strategic recommendations include resolving domain registration issues, implementing HTTPS and security headers, publishing privacy and cookie policies, providing clear contact information, and removing or properly configuring the WAF/security verification to allow legitimate user access.

70
100
57
85
2
15
50
securityverificationcaptchablockedwaf
Bootstrap 5.3.3Google reCAPTCHA v3
2026-07-12T07:18:06.048Z
sciencefestival.co.uk favicon

Edinburgh Science

sciencefestival.co.uk

65
EducationUnited KingdommediumMEDIUM

Edinburgh Science is a well-established educational charity founded in 1989, dedicated to delivering the annual Edinburgh Science Festival along with schools and community engagement programs. The organization positions itself as a leader in science education and public engagement within the UK, targeting a broad audience including schools, families, and community groups. Their business model is non-profit, focusing on educational outreach and charitable activities. The website reflects a professional and consistent brand image, with comprehensive content and clear navigation tailored to their audience. Technically, the website is built on WordPress 7.0.1, utilizing modern web technologies such as jQuery, Gravity Forms, Google Tag Manager, and various analytics and tracking tools including Google Analytics, Facebook Pixel, Hotjar, and Microsoft Clarity. The site is mobile-optimized, accessible, and SEO-friendly, with a moderate performance profile. Cookie consent and privacy compliance are well implemented, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA on forms to mitigate spam. While explicit security headers are not clearly detected, the site follows good practices by avoiding exposed sensitive data and using consent management tools. No vulnerabilities or malicious indicators were found. The lack of WHOIS data is due to a domain query error and does not reflect on the legitimacy of the organization, which is supported by consistent branding and external trust signals. Overall, Edinburgh Science presents a low-risk profile with strong business credibility and a good security posture. Strategic recommendations include enhancing security headers, maintaining up-to-date software, and improving incident response transparency to further strengthen trust and compliance.

60
100
47
60
83
85
2
scienceeducationfestivalcommunitycharity+2 more
WordPress 7.0.1jQuery 3.7.1Gravity FormsGoogle Tag Manager+6
2026-07-12T07:17:49.974Z
handselpress.org.uk favicon

Handsel Press

handselpress.org.uk

47
OtherUnited KingdomsmallHIGH

Handsel Press is a small, established not-for-profit publishing company based in the United Kingdom, specializing in Christian academic and popular books, poetry, and related literature. Founded in 1976 and owned by the Handsel Trust, it operates a professional WordPress-based e-commerce website to market and sell its publications. The company targets readers interested in theology, history, and the arts, emphasizing interdisciplinary dialogue and the Scottish democratic intellect tradition. The website features a clean design, clear navigation, and a moderate level of mobile optimization, supporting a positive user experience. Technically, the website leverages WordPress with WooCommerce and Elementor, integrating Google reCAPTCHA v3 for form security and Google Tag Manager for analytics. While the site uses HTTPS with excellent SSL configuration, it lacks explicit security headers and privacy/cookie policies, which are important for compliance and security best practices. Contact information is primarily available through a contact form, with no direct emails or phone numbers published. Social media presence is limited to Facebook. From a security perspective, the site demonstrates basic good practices such as HTTPS and spam protection but could improve by implementing security headers and publishing privacy and cookie policies to enhance GDPR compliance. The domain registration data is consistent with the business history, showing a long-standing and legitimate presence. Overall, the website is trustworthy and professional but would benefit from enhanced privacy and security measures to reduce compliance risks and improve user trust.

70
57
40
80
2
15
35
christianpublishingacademicbookspoetrytheologywordpress+1 more
WordPressWooCommerceElementorGoogle reCAPTCHA v3+1

Partner Domains:

simonpetermedia.com
partner
2026-07-12T07:17:44.600Z
danielcobb.co.uk favicon

Daniel Cobb Estate Agents Ltd

danielcobb.co.uk

66
Real EstateUnited KingdommediumMEDIUM

Daniel Cobb Estate Agents Ltd is a well-established independent real estate agency founded in 1994, specializing in property sales, lettings, and management across central London. The company emphasizes family values such as honesty, support, and trust, and operates multiple offices in key London areas including Kennington, Westminster, and London Bridge. Their service portfolio includes property sales, lettings, property management, valuations, land and developments, and in-house maintenance, positioning them as a leading independent agency in the London property market. Technically, the website is built on Joomla CMS and integrates modern web technologies including Google Analytics, Facebook Pixel, Google Maps API, and Google reCAPTCHA for security. The site is mobile-optimized with good SEO practices and includes cookie consent mechanisms compliant with GDPR. The presence of multiple social media channels and tracking tools indicates a mature digital marketing strategy. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms to mitigate spam and abuse. However, some security headers like Content-Security-Policy and X-Frame-Options are not detected, which could be improved to enhance security posture. No vulnerabilities or exposed sensitive data were found in the HTML content. The cookie consent and privacy policies are comprehensive and GDPR compliant. A notable concern is the WHOIS data failure for the domain www.danielcobb.co.uk, which the registry indicates as invalid due to naming rules. This discrepancy suggests possible domain misconfiguration or use of a subdomain, which impacts domain registration trustworthiness. Despite this, the website content, certifications, and social presence strongly support the legitimacy of the business. Overall, the website presents a professional, trustworthy, and user-friendly platform for real estate services in London, with minor technical and security improvements recommended to further st…

57
65
70
100
83
17
55
realestateestateagentslettingagentspropertymanagementlondon+2 more
Google AnalyticsFacebook PixelGoogle Maps APIjQuery+3
2026-07-12T07:17:39.216Z
B

B for BMW

b4bmw.co.uk

42
TransportationUnited KingdomsmallHIGH

B for BMW is an independent automotive service specialist focused on BMW vehicles, operating primarily in Glasgow, Clydebank, Edinburgh, and wider Scotland. The company offers a range of services including car repairs, MOT testing, servicing, air conditioning maintenance, and engine remapping. Positioned as an independent alternative to official BMW dealerships, the business targets BMW owners seeking specialized care. The website presents a professional image with clear contact details and integrated booking functionality, supporting customer engagement and service scheduling. Technically, the site employs modern web technologies such as Bootstrap 5, jQuery, and integrates third-party marketing and analytics tools including Google Analytics and Facebook Pixel. The site is mobile-optimized and exhibits good SEO practices, though accessibility features are basic. Security posture is adequate with HTTPS enforced and cookie consent implemented, but lacks advanced security headers and published security policies. The domain WHOIS data is unavailable due to a registration error indicating the domain name is invalid under Nominet UK rules, which raises concerns about domain legitimacy despite the professional website content. Overall, the site is functional and credible from a business perspective but would benefit from improved privacy and security transparency.

57
70
-
45
20
2
65
bmwautomotiveservicingrepairsmot+3 more
Bootstrap 5jQueryGoogle FontsFont Awesome 6+5
2026-07-12T07:17:22.587Z
F

Security Verification

farrellco.co.uk

48
OtherHIGH

The website www.farrellco.co.uk currently serves a security verification page protected by Google reCAPTCHA v3 invisible challenge, indicating the presence of a Web Application Firewall or bot protection mechanism. The actual business content is inaccessible without passing this verification, limiting the ability to analyze the company's services, market position, or contact details. The WHOIS lookup for the domain failed with an error indicating the domain name is invalid due to UK Nominet naming rules, suggesting a misconfiguration or incorrect domain usage. No registrant, registrar, or registration dates are available, which severely impacts trust and legitimacy assessments. Technically, the site uses Bootstrap 5.3.3 for styling and Google reCAPTCHA v3 for bot mitigation. No other frameworks, CMS, or hosting details are discernible. The page lacks visible security headers and privacy or cookie policies, and no contact information or business identifiers are present. This results in a low security posture and poor privacy compliance. Overall, the site is effectively blocked for normal users, and the lack of WHOIS data combined with the security challenge page suggests a high risk of misconfiguration or potential illegitimacy. Strategic recommendations include resolving domain registration issues, publishing clear privacy and cookie policies, adding contact and business information, and improving security headers and HTTPS configuration. Due to the blocking mechanisms and missing data, the overall risk assessment is high, and the site should be treated with caution until proper business and security transparency is established.

57
65
70
100
50
15
2
securityverificationcaptchabotprotection
Bootstrap 5.3.3Google reCAPTCHA v3
2026-07-12T07:17:17.188Z
londonaerons.co.uk favicon

London Aerons

londonaerons.co.uk

59
RetailUnited KingdomsmallMEDIUM

London Aerons is a niche e-commerce retailer specializing in premium Herman Miller Aeron office chairs targeted at office workers and home office users in London. The website presents a professional and consistent brand image with a focus on ergonomic office furniture, aiming to enhance comfort and productivity. The business appears to be a small-sized entity founded in 2012, with a clear market position in the retail sector for high-quality office chairs. Technically, the website is built on WordPress with WooCommerce, utilizing modern plugins such as WPBakery Page Builder and MonsterInsights for analytics. The site is hosted by Fasthosts Internet Ltd and employs HTTPS with strong SSL configuration, ensuring secure communications. Performance is moderate with good mobile optimization and basic accessibility features. SEO is well addressed with proper meta tags and structured data. From a security perspective, the site demonstrates good practices including HTTPS enforcement, security headers, and a cookie consent mechanism compliant with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, the site lacks explicit security policies, incident response contacts, and terms of service pages, which are recommended for enhanced trust and compliance. Overall, the website is trustworthy and professionally maintained with a solid security posture and privacy compliance. Strategic improvements in security documentation and contact transparency would further strengthen its risk profile and user confidence.

100
32
70
60
25
2
100
officechairshermanmilleraeronlondonergonomice-commerce+1 more
WordPressWooCommerceWPBakery Page BuilderGoogle Analytics+3
2026-07-12T07:17:11.801Z
gabb.co.uk favicon

Gabb & Co Solicitors

gabb.co.uk

64
Real EstateUnited KingdomsmallMEDIUM

Gabb & Co Solicitors is a well-established UK law firm founded in 1760, specializing in a broad range of legal services including commercial and residential property, company and commercial law, probate, tax advice, trusts, and wills. The firm serves individuals, businesses, and the agricultural community across the UK, maintaining a reputation for high-quality, approachable legal advice. Their market position is strengthened by longstanding client relationships and regulatory compliance with the Solicitors Regulation Authority. Technically, the website is built on WordPress with modern technologies such as jQuery, Contact Form 7, and Cloudflare Turnstile captcha for security. The site demonstrates good performance, excellent mobile optimization, and solid SEO and accessibility practices. Privacy and cookie policies are comprehensive and GDPR compliant, with clear consent mechanisms. From a security perspective, the site enforces HTTPS, uses captchas on forms, and avoids exposing sensitive data. However, it lacks explicit security headers and published security policies or incident response contacts. The WHOIS data is unavailable due to a domain query error, but the website's professional presentation and regulatory information support its legitimacy. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. Strategic improvements in security headers and transparency around security policies would further enhance trust and compliance.

57
100
70
85
15
83
17
legalsolicitorsuklawfirmproperty+4 more
jQueryContact Form 7Cloudflare Turnstile CaptchabxSlider
2026-07-12T07:16:55.326Z
emsleys.co.uk favicon

Emsleys Solicitors

emsleys.co.uk

63
Real EstateUnited KingdommediumMEDIUM

Emsleys Solicitors is a well-established, award-winning law firm based in Leeds, UK, providing a broad range of legal services including conveyancing, family law, employment law, dispute resolution, and wills & probate. The firm targets individuals and businesses primarily in Yorkshire and surrounding areas, positioning itself as a leading regional legal service provider with a strong reputation evidenced by multiple industry awards and excellent client reviews. Their business model focuses on client-centric, practical legal advice with fixed fee options to enhance transparency and accessibility. Technically, the website is built on a modern stack including Craft CMS, jQuery, Google Tag Manager, and Cookiebot for consent management, complemented by Plausible Analytics for privacy-friendly traffic analysis. The site is well-optimized for mobile and accessibility, with good SEO practices and fast loading performance. The presence of comprehensive metadata, structured data, and social media integration reflects a mature digital presence. From a security perspective, the site enforces HTTPS, uses CSRF tokens, and integrates cookie consent mechanisms, demonstrating adherence to best practices. No critical vulnerabilities or exposed sensitive data were detected. However, explicit security headers like X-Frame-Options and Content-Security-Policy should be verified and enhanced if missing. The absence of a published incident response or vulnerability disclosure policy is noted. Overall, the website presents a low-risk profile with strong business credibility and privacy compliance. The WHOIS data could not be retrieved due to querying a subdomain rather than the registered domain, but this does not detract from the legitimacy of the business. Strategic recommendations include enhancing security headers, publishing incident response and vulnerability disclosure policies, and maintaining up-to-date third-party libraries.

75
34
100
65
45
17
83
lawfirmsolicitorslegalservicesconveyancingfamilylaw+4 more
jQueryGoogle Tag ManagerCookiebot CMPPlausible Analytics+7

Partner Domains:

emsleysestateagents.co.uk
subsidiary
perfectportal.co.uk
partner
2026-07-12T07:16:28.461Z
budgetmedical.co.uk favicon

Budget Medical UK

budgetmedical.co.uk

58
HealthcareUnited KingdomsmallMEDIUM

Budget Medical UK operates as a specialist supplier and wholesaler of medical disposables and equipment, primarily targeting NHS GP surgeries, schools, government entities, and trade accounts within the United Kingdom. The company emphasizes its 25 years of expertise and offers value-added services such as free delivery over a certain order value and instant credit facilities for NHS GP surgeries. The website is built on the Shopify platform, leveraging modern e-commerce technologies and integrations such as Shopify Pay and hCaptcha for security. The digital infrastructure is moderately optimized for performance and mobile responsiveness, with a clear navigation structure and professional design. From a security perspective, the website enforces HTTPS and integrates CAPTCHA protections on forms, indicating a baseline security posture. However, explicit security headers and published security policies are absent, which could be improved to enhance trust and compliance. Privacy compliance is basic, with a cookie consent mechanism present but no clear privacy or terms of service pages detected in the homepage content. The WHOIS lookup for the domain failed due to domain naming rules, limiting the ability to verify domain registration details and impacting trust assessment. Overall, Budget Medical UK presents a credible and professional online presence within the healthcare supply sector, supported by a robust e-commerce platform. Strategic improvements in privacy disclosures, security headers, and domain registration transparency would further strengthen its security posture and business credibility.

65
55
100
44
35
17
73
healthcaremedicalsuppliese-commerceshopifyuk
ShopifyjQueryShopify PayhCaptcha+2
2026-07-12T07:16:12.128Z
B

buckleywatson.co.uk | 526: Invalid SSL certificate

buckleywatson.co.uk

48
OtherN/asmallHIGH

The website www.buckleywatson.co.uk is currently inaccessible due to an invalid SSL certificate on the origin server, as indicated by Cloudflare's Error 526 page. The domain WHOIS lookup failed with an error stating the domain cannot be registered because it contravenes Nominet UK's naming rules, suggesting the domain is either invalid or improperly registered. No business content, metadata, or contact information is available on the site, preventing any meaningful business or technical analysis. The site is protected by Cloudflare but is effectively blocked for visitors due to SSL misconfiguration. From a technical perspective, the site relies on Cloudflare as a proxy and security provider, but the origin server lacks a valid SSL certificate, causing the site to be inaccessible via HTTPS. No CMS, analytics, or marketing technologies are detected. The site lacks privacy, cookie, or terms of service policies, and no contact or security policies are present. Security posture is poor due to the invalid SSL certificate and absence of security headers or best practices. The domain registration issues further reduce trust and legitimacy. Overall, the site is not operational and presents significant risks and trust concerns. Strategic recommendations include promptly installing a valid SSL certificate on the origin server, resolving domain registration issues, implementing standard security headers, and publishing privacy and cookie policies to improve compliance and trust.

65
100
42
70
2
35
-
errorsslcloudflareblockedinvalid-certificate
Cloudflare
2026-07-12T07:14:56.751Z
kelvinfrancis.com favicon

Kelvin Francis Estate Agents

kelvinfrancis.com

52
Real EstateUnited KingdomsmallMEDIUM

Kelvin Francis Estate Agents is a well-established independent real estate agency based in Cardiff, UK, with over 46 years of experience. The company specializes in residential sales, lettings, valuations, and property management, serving Cardiff and surrounding areas through multiple offices. Their market position is strong, supported by multiple industry certifications and awards, reflecting a trusted and reputable brand in the local property market. The website effectively communicates their services and trust signals to their target audience of property buyers, sellers, landlords, and tenants. Technically, the website is built on WordPress using modern plugins and technologies such as WPBakery Page Builder, LayerSlider, Google Maps API, and Google Analytics. The site is mobile-optimized with good SEO practices and a moderate performance profile. Security measures include HTTPS, Google reCAPTCHA v3, and a cookie consent mechanism, although some advanced security headers and DNSSEC are not implemented. The security posture is solid but could be improved by enabling DNSSEC, adding security.txt for vulnerability disclosure, and implementing additional HTTP security headers. Privacy compliance is good with a comprehensive privacy policy and cookie consent banner. Contact information is clearly provided, enhancing business credibility. No signs of malicious content or suspicious domains were detected, and the domain registration data aligns well with the business claims, indicating high legitimacy. Overall, Kelvin Francis Estate Agents presents a professional, trustworthy, and user-friendly online presence with room for security enhancements to further strengthen their digital maturity and compliance posture.

75
20
70
57
68
17
25
estateagentspropertyrealestatelettingssales+4 more
WordPressPHPjQueryGoogle Maps API+6

Partner Domains:

guildproperty.co.uk
partner
muven.co.uk
partner

+1 more partners

2026-07-12T07:14:07.272Z
pyro2000.co.uk favicon

Pyro 2000 Ltd

pyro2000.co.uk

42
HospitalityUnited KingdomsmallHIGH

Pyro 2000 Ltd is a small, family-run professional firework display company based in Huddersfield, UK, with over 50 years of industry experience. They provide fireworks for weddings, corporate events, live concerts, charity events, and international competitions, positioning themselves as a reputable and experienced player in the event pyrotechnics market. The website reflects a professional and consistent brand image with clear service offerings and a strong social media presence. Technically, the website employs a modern tech stack including jQuery, Bootstrap, Font Awesome, and Google Analytics. The site is mobile-optimized with good SEO practices and moderate performance. However, it lacks some security headers and a cookie consent mechanism, which are important for compliance and security best practices. From a security perspective, the site uses HTTPS and does not expose sensitive data or vulnerable libraries. The absence of security headers and privacy compliance mechanisms are areas for improvement. The WHOIS data for the domain is unavailable due to a domain naming rules error, which slightly impacts trustworthiness but does not detract from the professional presentation and business legitimacy evident on the site. Overall, the website is well-designed and trustworthy for its business purpose, but improvements in privacy compliance and security headers are recommended to enhance security posture and regulatory adherence.

65
70
-
47
53
20
2
fireworksprofessionalserviceseventsweddingscorporate+3 more
jQueryBootstrapFont AwesomeGoogle Fonts+3
2026-07-12T07:14:01.916Z