Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157030
Websites
130
Industries
113
Countries
52
Avg Score
Page 898 of 3141|Showing 44851-44900 of 157030
jakfungujedns.cz favicon

CZ.NIC

jakfungujedns.cz

52
TechnologyCzech RepublicmediumMEDIUM

The website jakfungujedns.cz is an official educational platform operated by CZ.NIC, the Czech Republic's domain registry association responsible for managing the .CZ domain and DNS infrastructure. It provides clear, step-by-step educational content about how DNS works, targeting general internet users and those interested in internet technology. The site is well-branded with CZ.NIC logos and consistent messaging, reinforcing its authoritative position in the Czech internet ecosystem. Technically, the website uses standard web technologies including HTML5, CSS, JavaScript, and jQuery 1.11.0, along with Piwik analytics for user tracking. It is hosted likely on CZ.NIC infrastructure, ensuring reliability and performance. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. However, some technical improvements are possible, such as updating JavaScript libraries and enhancing accessibility features. From a security perspective, the site uses HTTPS and implements a cookie consent mechanism, demonstrating awareness of privacy regulations. However, it lacks visible security headers and a published privacy policy, which are important for compliance and user trust. No forms or sensitive data collection are present, reducing attack surface. The WHOIS data confirms the domain is legitimately registered to CZ.NIC, consistent with the website's purpose and content. Overall, the website is trustworthy, professionally maintained, and serves its educational purpose well. Strategic improvements in privacy documentation, security headers, and technical modernization would enhance its security posture and compliance standing.

80
25
2
60
52
75
40
dnseducationcznicdomainregistrytechnology
HTML5CSSJavaScriptjQuery 1.11.0+1
2025-10-17T18:00:47.893Z
ubereats.com favicon

Uber Technologies Inc.

ubereats.com

66
TransportationUnited StatesenterpriseMEDIUM

Uber Eats is a leading global online food and grocery delivery platform operated by Uber Technologies Inc. The website offers consumers the ability to order food and groceries from local restaurants and stores with contactless delivery options. It supports business accounts, restaurant sign-ups, and delivery partner registrations, positioning itself as a comprehensive marketplace in the food delivery sector. The platform is accessible via web and mobile apps, serving over 500 cities worldwide. Technically, the website is built using modern web technologies including React and various JavaScript libraries, with performance optimizations such as CDN usage and script preloading. It employs Google reCAPTCHA for bot defense and uses secure HTTPS connections with Content Security Policy measures. The site is well-optimized for mobile devices and accessibility, with good SEO practices evident. From a security perspective, Uber Eats demonstrates strong security posture with HTTPS, security headers, and no visible vulnerabilities or exposed sensitive data. However, explicit security policies, incident response contacts, and vulnerability disclosure mechanisms are not publicly found, which could be improved to enhance transparency and trust. Overall, the website is professional, trustworthy, and compliant with privacy regulations including GDPR. The lack of WHOIS data is due to privacy protection, which is justified for a large enterprise. The platform integrates extensive analytics and marketing tools, reflecting a mature digital marketing strategy. Strategic recommendations include publishing detailed security policies, incident response information, and vulnerability disclosure to further strengthen security culture and user trust.

65
100
25
65
-
85
100
fooddeliverygrocerydeliverye-commercetransportationonlineordering+2 more
ReactLodashStyletronGoogle reCAPTCHA+4

Partner Domains:

postmates.com
subsidiary
uber.com
parent
2025-10-17T18:00:22.816Z
carts.guru favicon

Carts Guru

carts.guru

56
E-commerceSpainmediumMEDIUM

Carts Guru is a specialized SaaS provider offering ecommerce marketing automation tools that enable online merchants to engage customers across multiple channels including email, SMS, and Facebook Messenger. The company targets ecommerce businesses seeking to increase revenue through automated, multichannel marketing campaigns and data-driven decision making. Their platform includes features such as campaign automation, audience segmentation, templates, and detailed dashboards, supported by a professional team offering premium support services. The website reflects a medium-sized business based in Spain with a strong market presence and over 1000 clients worldwide. Technically, the website is built on the Webflow platform, leveraging modern JavaScript libraries such as jQuery, Swiper, noUiSlider, and Select2. It is well optimized for mobile devices, fast loading, and SEO-friendly with proper meta tags and structured data. Google Tag Manager is used for analytics and marketing tracking. The site employs HTTPS with good SSL configuration but lacks some advanced security headers. Contact is primarily via a secure web form, with no direct email or phone contacts publicly listed. From a security perspective, the site demonstrates good practices including HTTPS enforcement and no visible sensitive data exposure. However, it lacks explicit cookie consent mechanisms and published incident response contacts or vulnerability disclosure policies. WHOIS data is unavailable due to privacy or query failure, which slightly reduces trust but is common for SaaS businesses. Overall, the security posture is solid but could be improved with additional transparency and security headers. The overall risk assessment is low with no critical issues detected. Strategic recommendations include implementing cookie consent, publishing incident response contacts, adding security headers, and maintaining regular vulnerability audits. The website is professional, trustworthy, and well-positioned in the ecommerce marketing automation sector.

15
53
17
50
52
80
100
ecommercemarketingautomationmultichannelemailmarketingsmsmarketing+3 more
Webflow CMSGoogle Tag ManagerjQuery 3.5.1noUiSlider+3
2025-10-17T17:58:21.628Z
refiner.io favicon

Dausinger Digital EURL

refiner.io

80
TechnologyFrancesmallLOW

Refiner.io is a specialized SaaS company providing in-app survey software tailored for web and mobile applications. Founded in 2014 and based in France, the company targets SaaS businesses and product teams seeking advanced user feedback solutions. Their platform emphasizes customizable microsurveys with precise user targeting and seamless integrations with popular analytics and marketing tools, positioning them as a niche player in the customer feedback and product research market. The website reflects a professional and consistent brand image with strong trust indicators such as client logos and testimonials. Technically, the site uses modern JavaScript technologies, integrates with Google Tag Manager, LinkedIn Insight, and Fathom Analytics, and is hosted on AWS infrastructure. Performance and mobile optimization are excellent, with good SEO and accessibility practices. Security posture is solid with HTTPS enforced and domain transfer protections, though DNSSEC is not enabled and security headers could be improved. Privacy compliance is well addressed with a comprehensive GDPR policy, but a cookie consent mechanism is missing despite tracking scripts. Contact information is primarily via web forms, with no direct emails or phone numbers publicly listed. Overall, Refiner.io demonstrates a mature digital presence with a strong focus on user feedback solutions for SaaS companies.

90
80
17
80
100
90
100
surveyin-appsurveysaascustomerfeedbacknps+4 more
JavaScriptGoogle Tag ManagerGoogle Ads TrackingLinkedIn Insight Tag+2
2025-10-17T17:57:56.568Z
myadlm.org favicon

Association for Diagnostics & Laboratory Medicine

myadlm.org

64
HealthcareUnited StatesmediumMEDIUM

The Association for Diagnostics & Laboratory Medicine (ADLM) is a professional organization focused on laboratory medicine and clinical chemistry. Founded recently in 2023, it serves a global community of clinical laboratorians, researchers, and healthcare professionals by providing educational resources, advocacy, networking opportunities, and scientific publications. The website reflects a mature and professional association with a strong emphasis on community engagement, education, and scientific advancement. ADLM positions itself as a key player in laboratory medicine with a comprehensive portfolio of services including conferences, journals, and certification programs. Technically, the website is built on a modern stack including Sitecore CMS, HubSpot marketing tools, Coveo search integration, and Cloudflare DNS services. The site is mobile-optimized, accessible, and SEO-friendly, though performance is moderate. The domain is registered with GoDaddy and protected with multiple EPP statuses, indicating a stable and legitimate registration. However, DNSSEC is not enabled, and security headers are not visibly configured, which are areas for improvement. From a security perspective, the site uses HTTPS and has protections against domain hijacking. Tracking and marketing scripts are present, but no explicit cookie consent mechanism was found, which may impact GDPR compliance. No incident response or security policy information is publicly available. Overall, the security posture is good but could be enhanced by adding security headers, enabling DNSSEC, and implementing privacy compliance features. The overall risk assessment is low with high trustworthiness and professionalism. Strategic recommendations include improving privacy compliance, enhancing security headers, and publishing security policies to increase transparency and user trust.

20
73
17
72
65
80
100
healthcarelaboratorymedicineeducationprofessionalassociationscientificresearch+1 more
JavaScriptjQueryHubSpotGoogle Tag Manager+2

Partner Domains:

harmonization.net
partner
comacc.org
partner

+2 more partners

2025-10-17T17:57:46.550Z
S

Scholarly iQ

scholarlyiq.com

61
TechnologyN/asmallMEDIUM

Scholarly iQ is a specialized service provider offering trusted data, analytics, and strategic consulting services primarily for the academic publishing market. Their key offerings include COUNTER compliance solutions, business intelligence, data management, and strategic consulting, targeting publishers, librarians, and other stakeholders in academic content usage. The company has a well-established presence with a domain registered since 2008 and a significant user base, positioning it as a credible player in its niche. Technically, the website employs a moderate technology stack including jQuery, Google Tag Manager, and Microsoft Clarity for analytics and tracking. The site enforces HTTPS and uses reputable hosting via GoDaddy. While the site is mobile optimized and has good navigation and design quality, it lacks advanced security headers and uses an outdated jQuery version, which could pose security risks. No cookie consent mechanism is present, indicating partial privacy compliance. From a security perspective, the site demonstrates basic good practices such as HTTPS enforcement and no visible sensitive data exposure. However, the absence of DNSSEC, security headers, and updated libraries suggests room for improvement. No incident response or security policy information is published, which could impact trust and compliance. Overall, Scholarly iQ presents a professional and trustworthy business website with solid content and business credibility but would benefit from enhanced security measures and privacy compliance to strengthen its posture and user trust.

15
53
17
80
62
85
100
academicpublishinganalyticscountercompliancedatamanagementbusinessintelligence+1 more
jQuery 1.12.2Google Tag ManagerMicrosoft ClarityTypekit Fonts
2025-10-17T17:57:31.485Z
R

Your access to this site has been limited by the site owner

rdm-ind.com

40
OtherN/asmallHIGH

The website rdm-ind.com is currently inaccessible due to a security block imposed by the Wordfence plugin, which is a widely used WordPress security solution. The block page indicates that access has been limited for security reasons, returning an HTTP 503 response. Due to this block, no substantive business content, contact information, or policies are publicly available for analysis. The domain is long-established, registered since 1999 with Bluehost Inc., which suggests legitimacy and stability in domain ownership. However, the lack of publicly accessible content severely limits the ability to assess the company's business model, services, or market position. From a technical perspective, the site is hosted on Bluehost and uses WordPress as its CMS, protected by Wordfence. No additional technologies, analytics, or advertising tools are detectable due to the block. Security posture is partially positive given the use of Wordfence, but the absence of DNSSEC and security headers is noted. Privacy compliance and business credibility cannot be evaluated due to missing information. Overall, the site presents a low risk in terms of content safety as it contains no adult or explicit material, but the security block restricts access to any meaningful content. Strategic recommendations include enabling DNSSEC, publishing privacy and cookie policies, and providing clear contact and incident response information to improve transparency and trust.

-
50
17
85
82
60
-
securitywordfenceblockedwafwordpress
Wordfence
2025-10-17T17:57:26.476Z
kronus.com favicon

KRONUS Inc.

kronus.com

55
HealthcareUnited StatessmallMEDIUM

KRONUS Inc. is a specialized healthcare company focused on providing immunoassay and autoimmune diagnostic test kits to medical professionals and laboratory facilities worldwide. With over 35 years of experience and an ISO 13485:2016 quality management certification, KRONUS positions itself as a trusted supplier in the niche market of endocrine and metabolic autoimmune disorder diagnostics. The website content clearly targets medical professionals and laboratories, emphasizing product quality and specialized services. Technically, the website employs a simple technology stack including jQuery 2.2.3 and custom CSS/JavaScript. The site is moderately optimized for performance and mobile devices, with good SEO practices evident in meta tags and structured navigation. However, the use of an outdated jQuery version and lack of modern security headers indicate areas for technical improvement. The hosting and domain registration are managed by reputable providers, supporting operational stability. From a security perspective, the website shows moderate maturity. The domain is secured with clientTransferProhibited status, but DNSSEC is not enabled, and no security headers were detected. There is no evidence of privacy or cookie policies, which presents compliance risks especially under GDPR. No incident response or vulnerability disclosure information is provided. Contact information is clearly available, supporting user trust and communication. Overall, KRONUS.com is a professional and trustworthy website with solid business credibility but with room for improvement in privacy compliance and security hardening. Strategic enhancements in these areas would strengthen the company’s digital trustworthiness and regulatory posture.

65
50
2
70
77
75
20
immunoassayautoimmunediagnosticsmedicaltestkitshealthcareiso13485
jQuery 2.2.3JavaScriptCSS
2025-10-17T17:57:21.467Z
polypipets.com favicon

Poly-Pipets, Inc.

polypipets.com

58
ManufacturingUnited StatessmallMEDIUM

Poly-Pipets, Inc. is a specialized manufacturer of disposable pipets primarily serving diagnostic kit manufacturers, laboratories, and healthcare providers. The company offers exact volume transfer pipets, single-use disposable dispensing and spreading pipets, and custom pipet design services. Founded in 2014, it positions itself as a woman-owned, ISO 9001:2015 certified business with a focus on quality and customer orientation. The website reflects a professional B2B business model with clear contact channels and product information. Technically, the website is built on WordPress with modern technologies such as jQuery, Google Tag Manager, and WP Rocket for performance optimization. The site is mobile-optimized, accessible, and SEO-friendly, with good loading speeds and structured metadata. Security measures include HTTPS enforcement, security headers, spam protection, and CAPTCHA integration, indicating a mature security posture. However, the absence of WHOIS domain registration data raises concerns about domain legitimacy and ownership transparency. Privacy compliance is partial, with a privacy policy present but lacking a cookie consent mechanism. No dedicated security or incident response policies are visible, which could be improved to enhance trust and compliance. Overall, the website is professional and trustworthy from a content and technical perspective but would benefit from improved privacy compliance and verification of domain registration details to strengthen its security and business credibility.

30
68
2
65
42
80
100
manufacturingpipetsdisposablehealthcarelaboratory+2 more
WordPressPHPjQueryGoogle Tag Manager+2
2025-10-17T17:57:11.450Z
jantdx.com favicon

Jant Pharmacal Corporation

jantdx.com

60
HealthcareN/amediumMEDIUM

Jant Pharmacal Corporation operates as a supplier of medical and laboratory diagnostic products, serving healthcare professionals and clinical laboratories. Established since 1986, the company offers a broad range of products including point-of-care diagnostics, laboratory analyzers, molecular testing solutions, and consulting services to improve laboratory efficiency and profitability. The website reflects a professional and consistent brand presence with clear navigation and relevant content targeting laboratory professionals. Technically, the website is built on WordPress with WooCommerce, leveraging modern technologies such as jQuery, Google Analytics, Google Tag Manager, and WP Rocket for performance optimization. The site is mobile-optimized and demonstrates good SEO and accessibility practices. Security measures include HTTPS enforcement and some security headers, with evidence of Wordfence security plugin usage. However, the absence of visible privacy and cookie policies, lack of security.txt or vulnerability disclosure pages, and missing WHOIS registration data present compliance and trust concerns. The WHOIS data absence is unusual for an active commercial site and warrants further investigation. Overall, the site maintains a good security posture but could improve transparency and compliance. Strategically, enhancing privacy compliance, incident response visibility, and domain registration transparency will strengthen trust and reduce risk. Regular security audits and updates to third-party scripts are recommended to maintain a robust security posture.

15
73
2
80
52
85
100
healthcarelaboratorydiagnosticsmedicalsuppliespoint-of-care+1 more
WordPressWooCommercejQueryGoogle Analytics+2
2025-10-17T17:57:01.427Z
evikdiagnostics.com favicon

Evik Diagnostics

evikdiagnostics.com

63
HealthcareCanadasmallMEDIUM

Evik Diagnostics is a specialized contract manufacturer focused on lyophilized reagent beads (Lyobeads) for diagnostic assays across medical, veterinary, environmental, and agricultural sectors. The company offers contract development, manufacturing, automation, and assay formulation services, supported by ISO 13485:2016 certification, indicating a strong commitment to quality management. Their website presents a professional image with clear service offerings and industry focus, targeting diagnostic manufacturers seeking stable, ambient storage assay reagents. Technically, the website is built on Joomla CMS with the T3 framework and Bootstrap 3, utilizing modern JavaScript libraries such as jQuery and Google Tag Manager for analytics. The site is mobile-optimized with good navigation and SEO practices, although accessibility features are basic. Security posture is moderate with no visible security headers or explicit SSL configuration details, and no privacy or cookie policies are present, indicating gaps in compliance and user data protection transparency. The WHOIS data is notably missing or unavailable, which raises concerns about domain registration legitimacy despite the active and professional website presence. This discrepancy lowers the overall trust score and suggests a need for further verification of domain ownership. No WAF or blocking mechanisms were detected, and the site content is safe and business-focused. Overall, Evik Diagnostics demonstrates a solid business and technical foundation but should address privacy compliance and domain registration transparency to enhance trust and security posture.

55
35
17
70
75
80
100
lyophilizedreagentbeadscontractmanufacturingdiagnosticassaysiso13485medicaldiagnostics
jQueryGoogle Tag ManagerFont Awesome
2025-10-17T17:56:46.388Z
takarabio.com favicon

Takara Bio USA, Inc.

takarabio.com

71
HealthcareUnited StateslargeMEDIUM

Takara Bio USA, Inc. is a prominent biotechnology company specializing in providing kits, reagents, instruments, and services to researchers focused on gene discovery, regulation, and function. As part of the Takara Bio Group, the company holds a strong market position with a commitment to advancing biotechnology and improving human health. Their offerings include custom enzyme services, OEM manufacturing, and gene and cell therapy manufacturing, targeting the scientific research community globally. The website infrastructure leverages modern web technologies including JavaScript frameworks, third-party marketing and analytics tools such as Marketo, Qualtrics, and Google Tag Manager, and video content delivery via Brightcove. The site is well-optimized for mobile and accessibility, with a professional design and clear navigation, supporting a positive user experience. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, though there is room for improvement in implementing additional security headers and enhancing incident response visibility. Privacy compliance is well addressed with comprehensive privacy and cookie policies aligned with GDPR requirements. Overall, the website presents a trustworthy and professional digital presence for Takara Bio USA, Inc., though the absence of publicly available WHOIS data slightly reduces domain trustworthiness. Strategic recommendations include enhancing security headers, auditing third-party scripts, and improving incident response contact information to further strengthen security and compliance.

50
68
17
85
77
85
100
biotechnologyresearchlifesciencesgeneeditingpcr+4 more
JavaScriptjQueryBrightcove video playerGoogle Tag Manager+3
2025-10-17T17:56:41.378Z
fortislife.com favicon

Fortis Life Sciences, LLC

fortislife.com

64
HealthcareUnited StatesmediumMEDIUM

Fortis Life Sciences, LLC is a medium-sized company operating in the healthcare sector, specializing in life sciences and diagnostics. The company offers a broad portfolio of products and services including reagents, diagnostic components, CDMO services, contract research and development, and biopharma solutions. Their website positions them as a trusted partner for life science and diagnostics companies, emphasizing integrated solutions designed to support complex development challenges and innovation scaling. The company targets B2B customers in research, diagnostics, and therapeutic markets. Technically, the website is built using modern web technologies such as React and Next.js, with Builder.io as the CMS platform. It employs Google reCAPTCHA for form security and loads efficiently with good mobile optimization and SEO practices. However, some security headers are missing, and there is no explicit cookie consent mechanism or detailed security policy published on the site. From a security perspective, the site uses HTTPS with a strong SSL configuration and implements bot protection on forms. The absence of WHOIS domain registration data raises concerns about domain legitimacy, although the professional website content and presence on LinkedIn support the business's credibility. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a professional and trustworthy front for Fortis Life Sciences, but improvements in domain registration transparency, security headers, and privacy compliance would enhance trust and security posture. Strategic recommendations include implementing security headers, publishing incident response and vulnerability disclosure policies, and adding cookie consent mechanisms to align with privacy regulations.

30
58
17
75
72
80
100
lifesciencesdiagnosticshealthcarebiopharmacdmo+2 more
ReactNext.jsGoogle reCAPTCHABuilder.io
2025-10-17T17:56:36.371Z
multiview.com favicon

Multiview

multiview.com

67
MediaN/amediumMEDIUM

Multiview is a professional B2B digital media agency specializing in marketing services for associations and businesses. The company focuses on helping clients reach, engage, and grow their most valued relationships through digital marketing strategies. Their market position is that of an established and reputable service provider in the B2B marketing space, leveraging modern marketing technologies and platforms such as HubSpot. The website reflects a medium-sized enterprise with consistent branding and good content quality. Technically, the website is built on the HubSpot CMS platform and integrates a variety of marketing and analytics tools including Google Analytics 4, Hotjar, Adobe DTM, and Snap Pixel. The site is mobile optimized and demonstrates good SEO and accessibility practices, although some accessibility features could be enhanced. Performance is moderate, with a modern tech stack and proper meta tags. From a security perspective, the site enforces HTTPS, uses security headers, and employs reCAPTCHA Enterprise to protect forms. Cookie consent mechanisms are in place, indicating GDPR compliance. However, the absence of a published security policy, incident response plan, and vulnerability disclosure program are gaps that could be addressed to improve security posture and transparency. Overall, the website is professional and trustworthy, but the lack of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. Strategic recommendations include publishing explicit security and incident response policies, implementing a vulnerability disclosure program, and enhancing accessibility compliance to further strengthen the site's security and trustworthiness.

45
88
17
75
65
65
100
b2bdigitalmarketingmediaagencymarketingservicesprivacy+3 more
jQueryGoogle Analytics 4HubSpotHotjar+4
2025-10-17T17:56:31.362Z
havas.bg favicon

Havas

havas.bg

41
MediaBulgariamediumHIGH

Havas.bg is the website of Havas, a creative agency specializing in connecting people and brands through creativity, media, and innovation. The site presents a portfolio of diverse projects for notable clients such as Vivacom, Baumit, Volkswagen, and others, indicating a strong presence in the Bulgarian advertising and media market. The business model revolves around providing creative and marketing services to corporate clients, positioning itself as a medium-sized agency with a professional digital presence. Technically, the website is built on WordPress, utilizing popular plugins like LayerSlider, Slider Revolution, and Visual Composer, along with standard web technologies such as jQuery and Google Fonts. The site is mobile-optimized and moderately performant, though some accessibility and SEO enhancements could be made. HTTPS is properly implemented, but security headers are missing, which could be improved to enhance security posture. From a security and compliance perspective, the site lacks visible privacy and cookie policies, as well as contact information for data protection or incident response, which are important for GDPR compliance and user trust. The WHOIS data is privacy-protected due to GDPR, which is justified for this business type, and no suspicious domain registration patterns were found. No WAF or blocking mechanisms were detected, and the content is safe for general audiences. Overall, the website is professional and functional but would benefit from improved privacy compliance, enhanced security headers, and clearer contact information to strengthen trust and regulatory adherence.

15
10
17
70
62
60
20
mediaadvertisingcreativeagencymarketingportfolio+1 more
WordPressPHPjQueryGoogle Fonts+6
2025-10-17T16:55:23.217Z