Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157342
Websites
130
Industries
113
Countries
52
Avg Score
Page 558 of 1064|Showing 27851-27900 of 53175
S

SIA NexALL

nexall.eu

44
TechnologyLatviasmallHIGH

NexALL is a Latvian-based company providing a specialized CRM software solution tailored for legal professionals and law firms. Their product focuses on secure and comprehensive client and case management, integrating critical features such as AML/KYC due diligence, sanctions list monitoring, time tracking, and invoicing. The website positions NexALL as a niche player with a strong emphasis on legal sector compliance and operational efficiency, supported by customer testimonials and client logos from Baltic region law firms. Technically, the website employs modern frontend technologies including Bootstrap 5, Font Awesome, jQuery, and Google Tag Manager for analytics. The site is mobile responsive with good design quality and clear navigation, though it lacks advanced SEO and accessibility features. No CMS or hosting provider details are explicitly identified. Analytics usage is moderate with Google Tag Manager but without visible cookie consent mechanisms, indicating potential privacy compliance gaps. From a security perspective, the site uses HTTPS but does not disclose security policies, incident response contacts, or vulnerability disclosure information. No security headers were detected in the provided data, and no privacy or cookie policies are present, which are critical for GDPR compliance. The WHOIS data is consistent and legitimate, registered to SIA AmberBit, matching the website's Latvian business focus. Overall, the website is professional and trustworthy but would benefit from enhanced privacy disclosures, security headers, and incident response transparency to improve compliance and security posture.

25
10
17
70
62
75
20
legalcrmlawyersclientmanagementcasemanagement+3 more
Bootstrap 5Font AwesomejQueryGoogle Tag Manager

Partner Domains:

eabirojs.lv
partner
magnussonlaw.com
partner

+3 more partners

2025-07-30T16:01:01.997Z
getmycolor.com favicon

Get My Color

getmycolor.com

68
E-commerceLatviasmallMEDIUM

Get My Color is a small, Latvia-based e-commerce business specializing in high-quality gel polish and related nail products. Founded in 2023, the company targets professional nail salons and businesses seeking fast shipping and premium products manufactured in Europe. Their website reflects a modern, professional e-commerce platform with clear product categorization, sample kits, and bulk order options. The presence of GMP and ISO9001 certifications, along with Trustpilot reviews, enhances their market credibility. Technically, the website leverages a modern tech stack including Laravel Livewire, Tailwind CSS, and various third-party marketing and analytics tools such as Google Tag Manager, Facebook Pixel, and Mouseflow. The site is mobile-optimized, fast-loading, and SEO-friendly, indicating a mature digital infrastructure for a small business. From a security perspective, the site uses HTTPS, has domain transfer protection enabled, and includes CSRF tokens for form security. However, DNSSEC is not enabled, and no explicit security or incident response policies are published. The site complies with GDPR and provides comprehensive privacy and cookie policies with consent mechanisms. Overall, the website is trustworthy, professionally maintained, and suitable for its target market. Recommendations include enabling DNSSEC, publishing a security policy, and adding a security.txt file to improve transparency and vulnerability management.

65
68
2
70
75
80
100
e-commercebeautygelpolishnailproductsretail+1 more
JavaScriptLivewire (Laravel)Tailwind CSSSwiper.js+6
2025-07-30T16:01:01.796Z
transformerimebeles.lv favicon

Transformeri mēbeles, transformējamas mēbeles – TRANSFORMERI MĒBELES

transformerimebeles.lv

58
RetailLatviasmallMEDIUM

The website transformerimebeles.lv is an e-commerce platform specializing in the sale of transformable furniture, targeting consumers seeking efficient space solutions in their homes. The business operates primarily in Latvia and leverages the Shopify platform for its online presence, offering customizable furniture options. The site demonstrates a professional design with good user experience and clear navigation, suitable for its target audience. Technically, the website is built on Shopify's Dawn theme and integrates modern marketing and analytics tools such as Google Tag Manager and Facebook Pixel. Security measures include HTTPS enforcement and the use of hCaptcha for form protection, although some security headers are not explicitly present. The site performs moderately well in terms of speed and mobile optimization. From a security perspective, the site shows a good baseline posture but lacks comprehensive privacy and cookie policies, which impacts its privacy compliance score. No WHOIS data was available due to query limits, limiting the ability to fully verify domain legitimacy. No contact information or incident response details were found, which could be improved to enhance trust. Overall, the website is a legitimate small retail business with a moderate security and privacy posture. Strategic improvements in policy transparency and security header implementation are recommended to strengthen compliance and trust.

75
10
17
55
57
80
100
e-commercefurnituretransformablefurnitureshopifyretail+1 more
ShopifyGoogle Tag ManagerFacebook PixelhCaptcha+1
2025-07-30T16:01:01.776Z
medart.lv favicon

Med Art klīnika

medart.lv

42
HealthcareLatviamediumHIGH

Med Art klīnika is a well-established healthcare center based in Latvia, specializing primarily in dermatology and related medical services. The clinic offers a broad range of treatments including aesthetic dermatology, laser therapy, surgery, and nutrition therapy, supported by a team of recognized specialists. The website supports online appointment booking and provides patient education resources, reflecting a modern approach to healthcare delivery. The clinic has a strong market position with over 20 years of operation and a significant patient base, enhancing its credibility in the Latvian healthcare sector. Technically, the website is built with standard web technologies including HTML5, CSS3, and JavaScript, and integrates Google Tag Manager for analytics and marketing purposes. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features could be improved. Performance is moderate, with a professional design and clear navigation structure. From a security perspective, the site enforces HTTPS and employs secure forms for data collection. However, it lacks explicit security headers and does not publicly disclose incident response or security policies, which are areas for improvement. Privacy and cookie policies are present and indicate compliance with GDPR, supporting user privacy and consent management. Overall, the website presents a professional and trustworthy digital presence for Med Art klīnika, with a solid security posture and compliance framework. The absence of WHOIS data limits full domain trust verification, but the content and business information align with a legitimate healthcare provider. Strategic recommendations include enhancing security headers, publishing incident response policies, and improving accessibility to further strengthen the site's security and compliance posture.

20
10
17
55
52
80
20
healthcaredermatologymedicalcliniclatviaonlinebooking+1 more
HTML5CSS3JavaScriptGoogle Tag Manager
2025-07-30T16:01:01.769Z
swatkids.lv favicon

vasaras dienas nometne bērniem swat kids droši ir zināt

swatkids.lv

58
EducationLatviasmallMEDIUM

The website www.swatkids.lv represents a Latvian children's summer day camp focused on safety education, self-defense, and active outdoor activities. It targets children and their parents in Riga, offering practical skills for assessing situations, decision-making, and appropriate actions in various environments including city, nature, and virtual spaces. The site positions itself as a local educational service provider with a clear mission to empower children with knowledge and confidence. Technically, the website is built on the Multiscreensite platform, utilizing modern web technologies such as jQuery, Google Analytics, Google Tag Manager, and Snowplow for analytics, as well as Mapbox for mapping services. It employs HTTPS with a good SSL configuration and registers a service worker for progressive web app capabilities. However, it lacks explicit security headers and visible privacy or cookie policies, which are important for compliance and security. From a security perspective, the site demonstrates basic good practices like HTTPS and CAPTCHA integration but misses critical elements such as security headers and formal privacy documentation. No vulnerabilities or exposed sensitive data were detected in the analyzed content. The absence of WHOIS data due to query limits restricts full domain trust verification, but the site content and contact information appear legitimate and consistent with a small educational business. Overall, the website is functional, professionally designed, and provides relevant content for its audience. To enhance trust and compliance, it should implement comprehensive privacy and cookie policies, improve security headers, and provide clearer data protection information. These steps will strengthen its security posture and regulatory adherence, supporting its business credibility and user trust.

55
10
17
60
72
75
100
summercampchildreneducationself-defenselatvia+2 more
jQuery 3.7.0skrollrGoogle Tag ManagerGoogle Analytics (gtag.js)+4
2025-07-30T16:01:01.752Z
vlc.lv favicon

VLC.LV - Vienmēr labas cenas

vlc.lv

47
RetailLatviamediumHIGH

VLC.lv is an e-commerce retail website based in Latvia specializing in the sale of returned, clearance, and refurbished electronics and household appliances. The website targets Latvian consumers looking for affordable technology and home devices. The business model focuses on offering discounted products through an online platform, positioning itself as a value retailer in the local market. The website's content is professionally presented with a clear focus on product offerings and pricing advantages. Technically, the website is built on the OpenCart platform, utilizing Bootstrap for responsive design and Google Tag Manager and Analytics for tracking user interactions. The site is mobile optimized and demonstrates moderate performance and SEO practices. However, there is a lack of visible privacy and cookie policies, and no contact information is explicitly provided in the analyzed content, which may impact user trust and compliance. From a security perspective, the site uses HTTPS (implied by base href https://vlc.lv/), but no security headers were detected in the provided data. There is no evidence of vulnerability disclosure, incident response contacts, or security certifications. The absence of WHOIS data due to query limits restricts the ability to fully assess domain legitimacy and registration consistency. Overall, the security posture is moderate but could be improved by implementing standard security headers and publishing privacy and security policies. The overall risk assessment suggests the website is legitimate and functional but would benefit from enhanced transparency and security practices to improve trustworthiness and compliance. Strategic recommendations include adding comprehensive privacy and cookie policies, implementing security headers, and providing clear contact and incident response information.

15
28
2
85
72
90
20
electronicsretailrefurbisheddiscounthouseholdappliances+2 more
Google Tag ManagerGoogle AnalyticsjQuery (implied by bootstrap and other scripts)Bootstrap+2
2025-07-30T16:01:01.686Z
F

FRUJO, a.s.

frujo.cz

51
ManufacturingCzech RepublicmediumMEDIUM

FRUJO, a.s. is a Czech-based manufacturer specializing in the production of food components such as fruit, vegetable, and other ingredient bases for various sectors of the food industry including dairy, bakery, and beverage industries. The company holds recognized certifications like IFS and BIO, indicating a commitment to quality and compliance. Their website is multilingual, targeting an international audience, and offers an e-commerce platform for related products. The business model focuses on supplying high-quality components to food manufacturers, supported by a professional online presence and clear contact information. Technically, the website is built on the aPilot CMS platform and integrates modern analytics and marketing tools such as Google Tag Manager, Google Analytics, and Leady tracking. It employs HTTPS and Google reCAPTCHA for security, with a cookie consent mechanism indicating some level of privacy compliance. The site is mobile-optimized and well-structured, providing a good user experience. From a security perspective, while HTTPS and reCAPTCHA are implemented, explicit security headers and a public security policy or incident response contacts are missing. No WHOIS data was retrievable, which raises some concerns about domain registration transparency but does not directly impact the legitimacy of the business as presented on the site. Overall, FRUJO presents a professional and trustworthy business front with room for improvement in security transparency and privacy policy publication. The risk level is moderate, primarily due to the lack of WHOIS data and some missing security best practices.

50
40
2
80
72
85
-
foodmanufacturingcomponentscertificationecommerce+1 more
Google Tag ManagerGoogle AnalyticsreCAPTCHAaPilot CMS+1

Partner Domains:

www.toje.cz
subsidiary
www.fruit-in-the-bottle.cz
subsidiary

+1 more partners

2025-07-30T16:01:01.602Z
norsan.lv favicon

Norsan Latvija

norsan.lv

52
RetailLatviamediumMEDIUM

Norsan Latvija operates as a premium Omega-3 nutritional supplement provider, positioning itself as the leading Omega-3 brand in German pharmacies and a key player in the European market. The company offers a range of high-quality Omega-3 oils, including wild fish and vegan algae-based products, supported by scientific research and certifications such as IFOS 5-star quality. Their business model focuses on e-commerce sales complemented by educational content and expert endorsements, targeting health-conscious consumers and athletes. Technically, the website is built on WordPress with WooCommerce, leveraging modern plugins for cookie consent, analytics, and payment processing. The site demonstrates good mobile optimization, accessibility, and SEO practices, with integration of Google Tag Manager and Facebook Pixel for marketing and analytics. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS, employs security headers, and uses cookie consent mechanisms, indicating a mature security posture. However, the absence of a dedicated security policy page and incident response contacts suggests areas for improvement. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a professional and trustworthy front for the business, though the lack of WHOIS data due to query limits restricts full domain trust verification. Strategic recommendations include enhancing transparency around security policies, incident response, and contact information to further strengthen trust and compliance.

25
25
17
40
57
75
100
omega-3healthsupplementse-commercenutritionlatvia+2 more
WordPressWooCommerceGoogle Tag ManagerBorlabs Cookie+4
2025-07-30T16:01:01.114Z
eleport.com favicon

Eleport

eleport.com

53
EnergyEstoniamediumMEDIUM

Eleport is a company operating a rapidly growing network of electric vehicle (EV) charging stations, primarily targeting sustainable travelers and EV owners. The business is positioned in the energy and transportation sectors, with a focus on providing convenient and flexible EV charging solutions. Their website offers information on charging station locations, pricing, and user guides, supporting their service-oriented business model. Founded in 2016 and based in Estonia, Eleport presents itself as a medium-sized enterprise with a consistent and professional online presence. Technically, the website is built on WordPress using Elementor and Jet Engine plugins, hosted likely on Microsoft Azure infrastructure as indicated by Azure DNS servers. The site employs modern web technologies including Google Tag Manager and Facebook Pixel for analytics and marketing, alongside Cookiebot for GDPR-compliant cookie consent management. The site demonstrates good SEO practices and mobile optimization, though accessibility features are basic. From a security perspective, the site uses HTTPS with a strong SSL configuration and enforces client transfer prohibition on the domain. However, DNSSEC is not enabled, and no explicit security headers were detected in the provided data. The site lacks published security policies, incident response contacts, and vulnerability disclosure mechanisms, which are areas for improvement. Cookie consent is implemented effectively, indicating good privacy compliance, though no explicit privacy policy or terms of service were found in the analyzed content. Overall, Eleport's website is professional, trustworthy, and technically sound, with moderate tracking and advertising practices typical for commercial sites. The absence of some compliance documents and security headers slightly reduces the security posture score. Strategic recommendations include enabling DNSSEC, adding security headers, publishing privacy and security policies, and implementing a vulnerability disclosure program to enhance trust and compliance.

25
83
2
80
72
80
-
evchargingsustainabilityenergytransportationelectricvehicles+1 more
WordPressElementorJet EngineGoogle Tag Manager+2
2025-07-30T16:01:01.001Z
vejaparki.lv favicon

SIA "Latvijas vēja parki"

vejaparki.lv

49
EnergyLatviamediumHIGH

SIA "Latvijas vēja parki" is a Latvian national company focused on the development, construction, and operation of strategically important wind parks to promote energy independence and renewable energy growth in Latvia. It operates as a subsidiary of AS "Latvenergo" since April 2024, aiming to add at least 800 MW of renewable energy capacity through approximately 130 modern wind turbines across the country. The company emphasizes responsible environmental practices and community engagement in its projects. Technically, the website employs modern web technologies including Bootstrap for responsive design, OpenLayers for interactive maps, and Usercentrics for cookie consent management. Google Tag Manager is used for analytics and tracking. The site is well-structured, mobile-optimized, and provides detailed project and contact information, although some standard compliance documents like privacy policy and terms of service are not explicitly found. From a security perspective, the site uses HTTPS and implements cookie consent, but lacks visible security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data due to query limits limits full domain trust analysis, but the site content and business information strongly indicate a legitimate state-owned enterprise. Overall, the website presents a professional and trustworthy digital presence for a key player in Latvia's renewable energy sector. Strategic recommendations include publishing privacy and security policies, enhancing security headers, and adding vulnerability disclosure mechanisms to improve compliance and trust.

-
10
17
70
42
75
100
renewableenergywindparkslatviaenergyindependenceenvironment+1 more
OpenLayers (ol.js) for mapsBootstrap 5 (navbar, accordion, tabs)FontAwesome iconsUsercentrics CMP for cookie consent+2

Partner Domains:

latvenergo.surveysparrow.com
partner
vpvb.gov.lv
partner

+1 more partners

2025-07-30T16:01:00.995Z
vetocentrs.lv favicon

Veterinārā klīnika Olainē

vetocentrs.lv

51
HealthcareLatviasmallMEDIUM

The website www.vetocentrs.lv represents a veterinary clinic located in Olainē, Latvia, offering a range of services including consultations, diagnostics, vaccinations, grooming, surgical procedures, and euthanasia. The business targets pet owners in the local region and positions itself as a compassionate and professional provider of veterinary care. The site is built on the Tilda CMS platform and incorporates common web technologies such as jQuery, Google Analytics, Facebook Pixel, and Google Tag Manager, indicating a moderate level of digital maturity. The presence of an online appointment widget further enhances user convenience. From a security perspective, the website uses HTTPS, ensuring encrypted communication. However, it lacks several important security headers that could improve protection against common web attacks. No privacy or cookie policies were found, which is a compliance gap especially relevant under GDPR regulations. Contact information is limited to a phone number, with no email or physical address explicitly provided in the analyzed content. The WHOIS data could not be retrieved due to query limits, limiting the ability to verify domain registration details. Overall, the website is professionally designed with good content quality and user experience. The security posture is adequate but could be improved by adding security headers and privacy compliance documentation. The risk level is moderate, with recommendations to enhance compliance and security practices to build greater trust and protect user data.

30
10
2
60
62
75
100
veterinaryclinicpetsanimalhealthlatvia+1 more
jQuery 1.10.2Google AnalyticsFacebook PixelGoogle Tag Manager+2
2025-07-30T16:01:00.901Z
hartig.lv favicon

SIA AMR PROJECTS

hartig.lv

58
RetailLatviasmallMEDIUM

HARTIG is a small Latvian e-commerce retailer specializing in handcrafted wooden products for children, home decor, and pets. The company operates a professionally designed Shopify-based website that effectively showcases its artisanal product offerings and targets consumers interested in quality wooden goods. The business provides clear contact information, including a physical address, phone number, and company registration details, enhancing its credibility in the retail market. Technically, the website leverages modern e-commerce technologies including Shopify's platform, Google Tag Manager, Microsoft Clarity, and various marketing pixels. The site demonstrates good performance, mobile optimization, and accessibility features, reflecting a mature digital infrastructure suitable for a small retail business. SEO practices are adequately implemented with proper metadata and structured data. From a security perspective, the website enforces HTTPS and employs CAPTCHA on forms, but lacks explicit security headers and published security policies. No cookie consent mechanism was detected, which may impact GDPR compliance. The absence of WHOIS data limits domain trust verification, though the visible business information and social media presence support legitimacy. Overall, the security posture is moderate with room for improvement in transparency and compliance. Strategically, HARTIG should focus on enhancing privacy compliance by implementing cookie consent banners and publishing security and incident response policies. Regular audits of third-party scripts and adding vulnerability disclosure mechanisms would further strengthen security. These steps will improve customer trust and regulatory adherence, supporting sustainable growth in the niche handcrafted wooden products market.

75
33
2
40
57
75
100
e-commercehandcraftedwoodenproductskidshomedecor+2 more
ShopifyJavaScriptGoogle Tag ManagerMicrosoft Clarity+3
2025-07-30T16:01:00.483Z