Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157342
Websites
130
Industries
113
Countries
52
Avg Score
Page 527 of 1003|Showing 26301-26350 of 50114
jahtas.eu favicon

SIA BOFORS

jahtas.eu

50
TransportationLatviasmallMEDIUM

Jahtas.lv, operated by SIA BOFORS, is a well-established Latvian company specializing in the sale and servicing of new and used watercraft since 2006. The company offers a comprehensive range of services including boat sales, winter storage, summer mooring, equipment sales, engine maintenance, hull repairs, and other boat management services. Positioned as a local leader in the water transport sector, Jahtas.lv targets boat owners and maritime enthusiasts primarily in Latvia. The website reflects a professional business with clear contact information and a detailed FAQ section, supporting customer engagement and trust. Technically, the website is built on WordPress using popular plugins such as Elementor and Revolution Slider, with SEO optimization via Rank Math and analytics through Google Analytics. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and security header implementation. Hosting is managed through GoDaddy, a reputable registrar and hosting provider. From a security perspective, the site uses HTTPS and includes reCAPTCHA for form protection, but lacks explicit security headers and published security policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is limited due to the absence of privacy and cookie policies, which is a notable compliance gap. Overall, the security posture is moderate but could be enhanced with additional measures. The overall risk assessment indicates a legitimate and trustworthy business with minor compliance and security improvements recommended. Strategic focus should be on enhancing privacy compliance, implementing security headers, and publishing incident response and vulnerability disclosure information to strengthen trust and regulatory adherence.

100
75
40
75
2
15
10
boatsyachtswatercraftmarineservicesboatsales+2 more
WordPressElementorRevolution SliderjQuery+5
2025-07-30T16:00:25.974Z
tara24.lv favicon

TARA24.LV stikla burku un pudeļu tirdzniecība

tara24.lv

41
RetailLatviasmallHIGH

TARA24.LV is a Latvian-based small retail and wholesale business specializing in glass jars, bottles, and related packaging products. The company operates an e-commerce website built on the PrestaShop platform, offering a broad assortment of glass packaging solutions to customers primarily in the Baltic region. The website is professionally designed with clear navigation and product categorization, targeting both retail consumers and business clients. Contact information and business registration details are clearly presented, supporting business credibility. Technically, the website leverages modern web technologies including Google Tag Manager and Google Analytics for marketing and analytics purposes. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. Security posture is adequate with HTTPS enforced, but lacks several important HTTP security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, no major vulnerabilities or exposed sensitive data were detected. However, the absence of security headers and formal privacy compliance mechanisms suggest moderate risk. The WHOIS data could not be retrieved due to query limits, limiting domain registration verification. Overall, the website appears legitimate and trustworthy for its business scope but would benefit from enhanced security and privacy practices. Strategic recommendations include implementing comprehensive privacy and cookie policies, adding security headers, publishing a security.txt file for vulnerability disclosure, and improving accessibility compliance. These steps would strengthen the site's security posture, regulatory compliance, and user trust.

70
62
20
75
20
2
10
e-commerceretailglasspackagingprestashoplatvia
PrestaShop CMSGoogle Tag ManagerGoogle AnalyticsjQuery+2
2025-07-30T16:00:25.968Z
S

SIA IM LATVIJA

topo.lv

9
Real EstateLatviasmallCRITICAL

SIA IM LATVIJA operates as a specialized surveying and geodesy service provider in Latvia, established in 2011. The company offers a range of services including topography, execution measurements, geodesy, aerial measurements, and 3D model creation, leveraging advanced Trimble technology to ensure high precision. Their market position is that of a small, service-oriented business focused on personalized client engagement and rapid order fulfillment across Latvia. The website reflects a professional and consistent brand image with clear contact information and business credentials. Technically, the website is built on WordPress using the Divi theme, incorporating modern web technologies such as jQuery, Google Fonts, and image optimization via Optimole. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with no critical technical issues detected. However, security headers are absent, and privacy-related policies are missing, indicating areas for improvement. From a security perspective, the site benefits from HTTPS encryption but lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of privacy and cookie policies reduces compliance with GDPR and related regulations. Overall, the security posture is moderate but could be enhanced by implementing recommended best practices. The overall risk assessment suggests a legitimate, small business website with good content quality and technical implementation but with gaps in privacy compliance and security transparency. Strategic recommendations include adding privacy and cookie policies, implementing security headers, establishing incident response contacts, and publishing vulnerability disclosure information to strengthen trust and compliance.

-
-
-
-
-
-
-
surveyinggeodesytopography3dmodelinglatvia+1 more
WordPressDivi ThemejQueryGoogle Fonts+2
2025-07-30T16:00:25.931Z
J

Jēkabpils Rezidence

jekabpilsrezidence.lv

48
HospitalityLatviasmallHIGH

Jēkabpils Rezidence is a regional business and tourism development association focused on promoting tourism, historical sites, culture, and accommodation in Jēkabpils, Latvia. The website serves as an informational portal highlighting local attractions, nature tourism, and active recreation opportunities. It targets tourists and visitors interested in exploring the region's heritage and natural beauty. The business model centers on regional promotion rather than direct commercial sales. Technically, the website is built on WordPress with common plugins such as Yoast SEO and uses jQuery and Bootstrap for frontend functionality. The site is served over HTTPS with a valid SSL certificate, indicating a secure connection. The design is responsive and user-friendly, with good SEO optimization and basic accessibility features. However, there is room for improvement in security headers and privacy compliance. From a security perspective, the site lacks explicit security policies, privacy and cookie policies, and incident response information. No contact emails or phone numbers are provided, which limits transparency and user trust. The absence of security headers and vulnerability disclosure mechanisms suggests a moderate security posture. No vulnerabilities or suspicious content were detected in the HTML content. WHOIS data could not be retrieved due to query limits, but the site appears legitimate and professional. Overall, the website is functional and informative with a moderate security and privacy posture. Strategic improvements in privacy compliance, security headers, and contact transparency would enhance trust and compliance. The domain's legitimacy cannot be fully verified due to WHOIS data unavailability, but no red flags were observed in the content or technical setup.

75
60
100
75
-
-
-
tourismaccommodationhistoryculturenature+4 more
WordPressYoast SEO pluginjQueryBootstrap
2025-07-30T16:00:25.926Z
amata.lv favicon

Amatas apvienības pārvalde

amata.lv

45
GovernmentLatviasmallHIGH

Amatas apvienības pārvalde operates as a local government administrative body serving the Amata region within the Cēsu municipality in Latvia. The website provides comprehensive information about municipal services, news, events, and public documents, targeting residents and stakeholders of the region. The organization maintains an active digital presence with social media integration and links to related government portals. Technically, the website employs modern JavaScript libraries such as jQuery, Slick Carousel, and Google Translate integration, ensuring a responsive and accessible user experience. The site is mobile optimized and includes accessibility features like font size adjustment and contrast settings. From a security perspective, the site uses HTTPS and implements cookie consent mechanisms, indicating awareness of privacy regulations such as GDPR. However, no advanced security headers or explicit security policies were detected, and WHOIS data was unavailable due to query limits, limiting full domain trust verification. Overall, the website demonstrates a solid digital infrastructure suitable for a government entity, with good content quality and user experience. Strategic improvements in security headers, incident response disclosures, and WHOIS transparency would enhance trust and compliance.

20
10
17
75
62
80
20
governmentmunicipalitylocaladministrationpublicserviceslatvia+1 more
jQuerySlick CarouselGoogle TranslateMagnific Popup+1
2025-07-30T16:00:25.808Z
solmed.lv favicon

“Sol Med”

solmed.lv

57
HealthcareLatviasmallMEDIUM

“Sol Med” is a Latvian medical center offering a comprehensive range of healthcare services including surgery, ultrasonography, dentistry, dermatovenerology, therapy, and hematology. The center emphasizes early diagnostics and provides access to highly qualified specialists without waiting lines. The website is professionally designed using WordPress CMS and includes detailed service descriptions, specialist profiles, and contact information, targeting patients seeking medical care in Latvia. Technically, the website employs modern web technologies such as jQuery, Visual Composer, and Google reCAPTCHA for form security. It is mobile-optimized and includes SEO best practices like meta tags and structured data. However, some security best practices like HTTP security headers are not detected, and the WHOIS data is unavailable due to query limits, limiting full trust verification. The security posture is moderate with HTTPS enabled and CAPTCHA protection on forms, but lacks visible security headers and documented incident response or vulnerability disclosure policies. Privacy compliance is partial, with a cookie consent banner present but no explicit privacy or terms of service pages found. Overall, the website is functional, professional, and trustworthy for healthcare service users, but could improve security and privacy transparency. The absence of WHOIS data reduces confidence in domain legitimacy verification.

20
25
17
70
75
75
100
healthcaremedicalcenterlatviaclinicultrasonography+3 more
jQueryWordPressVisual ComposerRevolution Slider+3
2025-07-30T16:00:25.602Z
S

SIA Hidrotehnika

hidrotehnika.lv

54
TransportationLatviasmallMEDIUM

SIA Hidrotehnika is a Latvian company specializing in hydraulic equipment sales, installation, and repair services primarily for trucks, forestry machinery, concrete pumping equipment, and road maintenance machinery. Established in 1999, it holds a leading position in the mobile hydraulic equipment service sector within Latvia. The company operates from a sizable facility in Riga and employs qualified specialists trained in manufacturer-specific courses. The website reflects a professional business presence with clear service descriptions and contact information, targeting B2B customers in the industrial and transportation sectors. Technically, the website is built on WordPress with WooCommerce, enhanced by plugins such as Google Tag Manager and reCAPTCHA for analytics and security. The site enforces HTTPS and includes cookie consent mechanisms, indicating a reasonable level of digital maturity. However, some security best practices like HTTP security headers are missing, which could be improved to enhance protection. From a security perspective, the site shows good baseline measures but lacks advanced headers and explicit security policies. The contact form uses reCAPTCHA to mitigate spam. No vulnerabilities or malicious content were detected in the analysis. WHOIS data was unavailable due to query limits, limiting domain registration verification. Overall, the website is a solid representation of a small Latvian industrial service provider with good content quality and moderate technical implementation. Security posture is adequate but could benefit from enhancements. Privacy compliance is well addressed with clear policies and consent mechanisms. The risk level is moderate with no critical issues identified.

15
85
2
85
72
75
20
hydraulicstruckserviceconcretepumpsforestrymachineryroadmaintenance+3 more
WordPress 4.8.25WooCommerce 3.6.7jQueryGoogle reCAPTCHA+4
2025-07-30T16:00:25.530Z
equitsia.lv favicon

SIA equitsia

equitsia.lv

44
FinanceLatviasmallHIGH

SIA equitsia is a German-owned family office based in Riga, Latvia, managing a private investment portfolio since 2006. The company also provides consultancy services focused on investment and relocation. The website presents a professional but basic digital presence, targeting affluent individuals and families interested in financial and relocation services in the Baltic region. The business model centers on personalized family office management and advisory services, positioning itself as a niche player in the Latvian market. Technically, the website is built on WordPress using common frameworks and libraries such as Bootstrap, jQuery, and Elementor. It integrates Google Analytics via Google Tag Manager for visitor tracking. The site is mobile-optimized with a moderate performance profile and basic accessibility features. SEO is supported by Yoast SEO plugin, with proper meta tags and structured data in JSON-LD format. From a security perspective, the site enforces HTTPS and does not expose sensitive data in the HTML content. However, it lacks important security headers and visible privacy or cookie policies, which are critical for GDPR compliance and user trust. No incident response or vulnerability disclosure information is provided, indicating room for improvement in security transparency and readiness. Overall, the website is functional and professional but could benefit from enhanced privacy compliance, security hardening, and clearer trust signals to improve user confidence and regulatory adherence.

15
10
2
80
67
85
20
familyofficeinvestmentrelocationfinanceriga+1 more
jQueryBootstrapFont AwesomeOwl Carousel+3
2025-07-30T16:00:25.527Z
sumus.lv favicon

SUMUS SIA Sumus

sumus.lv

55
OtherLatviasmallMEDIUM

SUMUS SIA Sumus operates a professional cleaning service primarily targeting businesses and private clients in Latvia. The company offers a broad range of cleaning solutions including office cleaning, general cleaning, window washing, carpet chemical cleaning, floor waxing, and post-renovation cleaning. Their market position is supported by ISO certifications (ISO 9001, ISO 14001, ISO 45001), indicating a commitment to quality, environmental management, and occupational health and safety. The website is well-structured, professionally designed, and provides clear contact information and client testimonials, enhancing trust and credibility. Technically, the website is built on WordPress with Elementor and uses modern libraries such as jQuery, Bootstrap, and Slick Slider. It integrates Google Analytics, Google Tag Manager, Facebook Pixel, and Bing Ads for marketing and analytics purposes. The site employs HTTPS and reCAPTCHA for security, though some security headers are not explicitly confirmed. Privacy and cookie policies are present with consent mechanisms, indicating good privacy compliance. Security posture is solid with no visible vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to query limits restricts full domain trust verification. Overall, the site demonstrates a mature digital presence with good security and privacy practices, suitable for its business domain. Recommendations include implementing and verifying security headers, maintaining up-to-date software, and monitoring third-party scripts for privacy compliance to further enhance security and trust.

30
10
2
65
72
85
100
cleaningprofessionalservicesisocertifiedlatviaofficecleaning+1 more
jQueryBootstrapSlick SliderLightbox+5
2025-07-30T16:00:25.497Z