Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 5 of 82|Showing 201-250 of 4099
reedps.com favicon

Reed Professional Services

reedps.com

74
TechnologyUnited KingdommediumMEDIUM

Reed Professional Services is a consultancy arm of the Reed Global Group specializing in digital and business transformation solutions. The company serves a broad range of clients across public and private sectors, offering services such as project management, software development, IT strategy, change management, and HR transformation. The website reflects a mature digital presence with comprehensive content, client testimonials, and case studies that reinforce its market position as a trusted transformation partner. Technically, the website is built on WordPress with modern plugins and tracking technologies including HubSpot, Google Tag Manager, Microsoft Clarity, and LinkedIn Insight. The site is mobile-optimized, SEO-friendly, and uses HTTPS with good SSL configuration. However, explicit security headers are not fully implemented, and WHOIS data for the domain is missing, which raises some concerns about domain registration transparency. From a security perspective, the site follows good practices with consent management and secure form handling, but lacks a public security policy or incident response contacts. The extensive use of third-party analytics and marketing scripts indicates a high level of user tracking, balanced by GDPR-compliant privacy and cookie policies. Overall, the website presents a professional and trustworthy image with strong business credibility. The main risk lies in the lack of WHOIS transparency and incomplete security headers, which should be addressed to enhance trust and security posture.

80
62
85
100
95
2
85
consultancydigitaltransformationbusinesstransformationprojectmanagementsoftwaredevelopment+3 more
WordPressContact Form 7Complianz GDPR pluginGoogle Tag Manager+5

Partner Domains:

www.reedtalentsolutions.com
partner
www.reed.com
partner

+3 more partners

2026-07-05T07:15:42.331Z
B

Bow House Digital Ltd

bowhouse.co.uk

47
TechnologyUnited KingdomsmallHIGH

Bow House Digital Ltd is a small, established digital agency based in York, United Kingdom, specializing in web design, SEO, WordPress websites, e-commerce, branding, and digital marketing services. With over 25 years of industry experience, the company targets businesses in York and North Yorkshire seeking to enhance their online presence and digital marketing effectiveness. The website reflects a professional and consistent brand image, supported by client testimonials and a portfolio of recent projects, positioning Bow House as a trusted local partner in digital services. Technically, the website is built on WordPress CMS, leveraging modern JavaScript libraries such as jQuery, GSAP, and Slick Carousel for enhanced user experience. It integrates Google Tag Manager and LinkedIn Insight for analytics and marketing, and employs Google reCAPTCHA to secure its contact forms. The site is mobile-optimized and SEO-friendly, with comprehensive metadata and structured data enhancing search visibility. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to mitigate spam. However, it lacks explicit security headers like Content-Security-Policy and X-Frame-Options, which are recommended to strengthen security posture. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy and cookie policies are present and indicate GDPR compliance, supporting responsible data handling. Overall, the website demonstrates a strong digital maturity and business credibility with minor areas for security enhancement. The absence of WHOIS data due to a domain query error does not detract from the legitimacy of the business, as corroborated by company registration details and consistent branding. Strategic recommendations include implementing additional security headers, enhancing accessibility, and maintaining up-to-date software to mitigate potential risks.

60
67
-
65
68
15
17
webdesigndigitalmarketingseowordpresse-commerce+3 more
WordPressjQueryGSAPSlick Carousel+3
2026-07-05T07:09:36.961Z
tsg.je favicon

Total Solutions Group (TSG) Jersey

tsg.je

61
TechnologyJerseymediumMEDIUM

Total Solutions Group (TSG) Jersey is a leading information management and technology services provider based in Jersey, serving clients across the Channel Islands, UK, Gibraltar, Mauritius, and South Africa. The company offers a broad range of services including document management, scanner hardware support, robotic process automation, GDPR consultancy, and information security. Their market position is strong regionally, supported by partnerships with recognized technology providers such as Kofax and Mitratech. The website reflects a professional business model focused on B2B services with clear contact channels and trust indicators such as Cyber Essentials certification. Technically, the website is built on WordPress using modern plugins like WPBakery Page Builder and LayerSlider. It employs HTTPS with good SSL configuration and includes responsive design elements for mobile optimization. However, some technical improvements are recommended, including the implementation of security headers and proper configuration of analytics tools. The website's performance is moderate with basic SEO and accessibility features. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and no visible sensitive data exposure. The presence of Cyber Essentials certification indicates a commitment to security standards. However, the absence of security headers and lack of an incident response or vulnerability disclosure policy are areas for improvement. Privacy compliance is partially met with privacy and cookie policies present, but the lack of a cookie consent mechanism reduces compliance confidence. Overall, the website is trustworthy, professional, and well-positioned in its market niche. Strategic recommendations include enhancing security headers, implementing cookie consent, configuring analytics properly, and publishing explicit security and incident response policies to strengthen compliance and trust.

62
70
72
20
80
55
47
informationmanagementtechnologyservicesconsultancydocumentmanagementroboticprocessautomation+2 more
WordPressPHPjQueryLayerSlider+4

Partner Domains:

kofax.com
partner
mitratech.com
partner
2026-07-04T07:20:06.691Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
P

Prestige Roofing Ltd

prestige-roofing.co.uk

35
Real EstateUnited KingdomsmallHIGH

Prestige Roofing Ltd is a well-established roofing company based in London, providing residential and commercial roofing services including new roof installations, re-roofing, emergency repairs, and cladding installation. The company has over 40 years of experience and holds reputable certifications such as Which? Trusted Trader and membership in the Guild of Master Craftsmen, positioning it as a trusted service provider in its market segment. The website reflects a professional business with clear service offerings and customer testimonials supporting its credibility. Technically, the website is built on WordPress with a modern tech stack including popular plugins for analytics, forms, and sliders. It uses HTTPS and has moderate performance and good mobile optimization. However, some security best practices such as security headers and cookie consent mechanisms are missing, which could be improved to enhance compliance and security posture. Security-wise, the site shows no immediate vulnerabilities or exposed sensitive data, but the absence of security headers and incident response information indicates room for improvement. The WHOIS data is unavailable due to domain naming rules errors, which limits domain trust verification, but the website content and certifications provide compensating trust signals. Overall, the website is professional and trustworthy with moderate technical maturity and a good security baseline. Strategic improvements in privacy compliance and security hardening are recommended to further strengthen the company's digital presence and trustworthiness.

40
60
-
52
15
2
35
roofingconstructionservicesuktrustedtrader+2 more
WordPress 5.7.15PHPjQuery 3.5.1Revolution Slider 5.4.1+5
2026-07-04T07:12:49.391Z
ukpworldwide.com favicon

UKP Worldwide

ukpworldwide.com

46
OtherUnited KingdomsmallHIGH

UKP Worldwide is a specialist service provider focusing on customs clearance for eCommerce parcels and mail to and from the UK, including returns management and duty reclaim services. The company targets businesses involved in eCommerce logistics, offering niche expertise in customs and returns processes. The website presents a professional and consistent brand image with clear business descriptions and social media presence, indicating a small but focused operation founded around 2019. Technically, the website is built on WordPress using the Divi theme and common plugins such as Yoast SEO and Contact Form 7. It employs tracking and analytics tools like Microsoft Clarity and Google Tag Manager, indicating a moderate level of digital maturity. The site is mobile optimized and SEO friendly but lacks advanced accessibility features. From a security perspective, the website lacks visible security headers and explicit privacy or cookie policies, which reduces its compliance posture. The WHOIS data is incomplete or unavailable, raising concerns about domain registration transparency. No critical vulnerabilities or exposed sensitive data were detected, but improvements in security best practices and compliance documentation are recommended. Overall, the website is functional and professional but would benefit from enhanced security configurations, transparent privacy policies, and verified domain registration information to improve trust and compliance.

70
20
70
57
68
15
2
customsclearanceecommercereturnsmanagementdutyreclaimlogistics+1 more
Google Tag ManagerMicrosoft ClarityYoast SEOContact Form 7+2
2026-07-04T07:10:26.611Z
U

Universal Converting Equipment

universalconvertingequipment.com

60
ManufacturingUnited KingdommediumMEDIUM

Universal Converting Equipment is a UK-based manufacturer and supplier specializing in converting machinery such as slitter rewinders, core cutters, salvage rewinders, and hot melt coating systems. The company positions itself as a leading global supplier with a focus on substantial construction, simple operation, and worldwide support. Their business model targets industrial manufacturers and converting industry professionals worldwide, leveraging a B2B approach. The website reflects a professional and consistent brand image with clear product offerings and UK-based contact information. Technically, the website is built on WordPress using a modern stack including Yoast SEO, Google Tag Manager, and GDPR-compliant cookie management. The site is mobile-optimized with good SEO and accessibility basics. Analytics and marketing tools such as Google Analytics, Hotjar, Facebook Pixel, and LinkedIn Insight Tag are integrated with user consent mechanisms. From a security perspective, the site enforces HTTPS and uses reCAPTCHA for forms, but lacks explicit security policy or incident response disclosures. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of WHOIS domain registration data raises concerns about domain legitimacy and trustworthiness, warranting further verification. Overall, the website presents a solid digital presence for an industrial equipment supplier with good privacy compliance and marketing practices. Strategic recommendations include enhancing security headers, publishing security policies, and resolving WHOIS data inconsistencies to improve trust and compliance.

15
80
17
85
37
70
100
manufacturingindustrialequipmentslitterrewindershotmeltcoatingcorecutters+4 more
WordPressYoast SEO pluginGoogle Tag ManagerGoogle Analytics+7
2026-07-03T07:28:59.055Z
oglemodels.com favicon

Ogle Models & Prototypes Ltd

oglemodels.com

55
ManufacturingUnited KingdommediumMEDIUM

Ogle Models & Prototypes Ltd is a well-established UK-based company specializing in rapid prototyping, model making, and 3D printing services. With over 70 years of experience, the company serves a diverse range of industries including aerospace, automotive, medical, and product design. Their key services include advanced manufacturing techniques such as SLS, SLA, FDM 3D printing, CNC machining, vacuum casting, and finishing processes. The website reflects a mature digital presence with comprehensive service descriptions, client testimonials, and a professional design that supports their market position as a leading prototype engineering firm. Technically, the website is built on WordPress with modern frameworks like Bootstrap and integrates multiple analytics and marketing tools such as Google Analytics, Facebook Pixel, Hotjar, and LiveChat for customer engagement and data insights. The site is mobile-optimized, SEO-friendly, and includes structured data for enhanced search engine visibility. Security measures include HTTPS enforcement, reCAPTCHA on forms, and cookie consent mechanisms, although additional HTTP security headers could further strengthen the security posture. From a security and compliance perspective, the site demonstrates good privacy and cookie policy implementations aligned with GDPR requirements. However, no explicit security policy or incident response contact information is published, which could be improved. The WHOIS data for the domain is unavailable, which raises some transparency concerns, but the overall legitimacy is supported by the professional content, certifications, and client base. Overall, Ogle Models presents a trustworthy and professional online presence suitable for its B2B manufacturing audience. Strategic recommendations include enhancing security headers, publishing a security policy, and improving WHOIS transparency to further bolster trust and compliance.

42
100
70
45
15
68
17
rapidprototyping3dprintingmodelmakingmanufacturingengineeringprototypes+2 more
jQueryBootstrapGoogle Tag ManagerGoogle Analytics+5
2026-07-03T07:28:08.729Z
jmdaccounting.com favicon

JMD Accounting Ltd

jmdaccounting.com

60
FinanceUnited KingdomsmallMEDIUM

JMD Accounting Ltd is a small, professional accounting and bookkeeping service provider based in Surrey, United Kingdom. The company specializes in tax accounting services tailored for small businesses, offering a comprehensive range of services including Making Tax Digital support, payroll, VAT returns, self-assessment, and company filings. The business is led by Janette Dalgliesh, a qualified CIMA member since 1996, emphasizing expertise and trustworthiness in the financial services sector. The website reflects a focused local market position with clear contact channels and professional branding. Technically, the website is built on WordPress using Elementor and several popular plugins such as Slider Revolution, Yoast SEO, and WPForms. It employs modern web technologies and integrates Google Analytics and Google reCAPTCHA v3 for user tracking and form security. The site is mobile-optimized and demonstrates good SEO practices, although some security headers are missing and DNSSEC is not enabled, which are areas for improvement. From a security perspective, the site uses HTTPS with a valid SSL certificate and implements reCAPTCHA on forms to mitigate spam. Privacy and cookie policies are present and GDPR compliant, with a functional consent mechanism. However, there is no explicit security policy or incident response information published, and no vulnerability disclosure or security.txt file is found. The WHOIS data is consistent with the business claims, showing a domain registered since 2007, supporting the legitimacy and stability of the company. Overall, JMD Accounting Ltd presents a trustworthy and professional online presence with solid business credibility and a good security posture. Minor enhancements in security headers, DNSSEC, and transparency around incident response could further strengthen their digital maturity and customer trust.

15
80
2
70
57
70
100
accountingbookkeepingtaxsmallbusinesssurrey+6 more
WordPressElementorSlider RevolutionYoast SEO+5
2026-07-03T07:25:31.515Z
fletchersengineering.co.uk favicon

Fletchers Engineering

fletchersengineering.co.uk

47
ManufacturingUnited KingdommediumHIGH

Fletchers Engineering is a well-established UK-based engineering company specializing in HVAC fabrication, installation, and maintenance services. With over 30 years of industry experience, the company serves a diverse range of sectors including energy, manufacturing, hospitality, and government. Their website reflects a professional and comprehensive presentation of their services, supported by multiple industry accreditations and certifications, positioning them as a reputable player in their market segment. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Slick Slider, and integrates key tools like Google Analytics, Hotjar, and Google reCAPTCHA for analytics and security. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms, indicating a mature digital presence. However, some improvements in accessibility and security headers could enhance the technical posture. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security policies and incident response information. The WHOIS data is unavailable due to a query on the subdomain rather than the registered domain, which slightly reduces trustworthiness from a domain registration standpoint. Overall, the security posture is good but could benefit from additional transparency and technical hardening. The overall risk assessment is moderate-low, with the main concerns being the incomplete WHOIS data and absence of published security policies. Strategic recommendations include verifying domain registration details, implementing security.txt and incident response pages, and enhancing HTTP security headers to improve trust and compliance.

20
80
25
2
60
40
67
hvacengineeringfabricationmaintenanceuk+4 more
WordPressjQuerySlick SliderGoogle reCAPTCHA+4
2026-07-03T07:14:36.022Z
K

Kingston Cleaning Services

kingstoncleaningservices.co.uk

51
OtherUnited KingdommediumMEDIUM

Kingston Cleaning Services (KCS) is a UK-based commercial and industrial cleaning company specializing in a wide range of interior and exterior cleaning services across Yorkshire and the UK. The company serves diverse sectors including commercial, industrial, and domestic clients, offering services such as building fabric cleaning, window cleaning, pressure washing, and high-level cleaning. KCS emphasizes health and safety, with trained teams and strong site compliance, positioning itself as a reliable and reputable cleaning partner with over 70 years of combined experience in the industry. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics integrated. The site is mobile-optimized with good navigation and content structure, though some security headers could be improved. The website uses HTTPS and reCAPTCHA for form security, reflecting a moderate to good security posture. Security-wise, the site demonstrates good practices including HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. However, it lacks explicit incident response contacts and a vulnerability disclosure policy, which are recommended for enhanced security maturity. Privacy and cookie policies are present and appear GDPR compliant, supporting privacy compliance. Overall, the website is professional, trustworthy, and well-maintained, though the WHOIS data is unavailable due to domain registration lookup issues. This does not detract from the legitimacy of the business, but it is recommended to verify domain registration details through alternative means. Strategic improvements in security headers and incident response transparency would further strengthen the security posture.

40
70
60
57
17
15
68
cleaningcommercialcleaningindustrialcleaningwindowcleaningpressurewashing+3 more
WordPressYoast SEOGoogle Tag ManagerGoogle Analytics+2
2026-07-03T07:09:43.497Z
shepherd.co.uk favicon

Shepherd Chartered Surveyors

shepherd.co.uk

52
Real EstateUnited KingdomlargeMEDIUM

Shepherd Chartered Surveyors is a leading property surveying and valuation firm based in Scotland, with a history dating back to 1880. The company offers a broad range of services including residential home reports, commercial property search, valuations, lease advisory, and asset management. Their market position is strong within Scotland, supported by a nationwide office network and a merger with Hardies Property and Construction Consultants. The website reflects a professional and well-established business with a focus on property clients and investors. Technically, the website is built on WordPress using popular plugins such as WPBakery Page Builder and Slider Revolution. It integrates Google Analytics and Tag Manager for tracking and marketing purposes, alongside customer review widgets from Reviews.io. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features are basic. From a security perspective, the site enforces HTTPS and uses spam protection on forms and cookie consent mechanisms, indicating a reasonable security posture. However, explicit security headers and detailed security policies are not publicly visible, suggesting room for improvement in transparency and hardening. The WHOIS data query was unsuccessful due to an invalid domain format, which slightly impacts trust but does not detract from the professional appearance and content of the site. Overall, the website presents a credible and trustworthy business with good technical implementation and moderate privacy compliance. Strategic improvements in security transparency and privacy policy visibility would enhance the site's trustworthiness and compliance posture.

85
47
70
20
15
2
100
realestatecharteredsurveyorspropertyvaluationcommercialpropertyhomereports+1 more
WordPressWPBakery Page BuilderSlider RevolutionGoogle Tag Manager+6

Partner Domains:

hardies.co.uk
sister
careers.shepherd.co.uk
related
2026-07-02T07:09:24.522Z
readingspropertygroup.com favicon

Readings Property Group

readingspropertygroup.com

54
Real EstateUnited KingdomsmallMEDIUM

Readings Property Group is a small, established real estate agency based in Leicestershire, United Kingdom, specializing in residential and commercial property sales and lettings. Founded in 2010, the company positions itself as a local expert on the Leicestershire property market, offering services to buyers, renters, and sellers. The website reflects a professional business with clear branding and a focus on property services in the local area. The target audience includes individuals and businesses seeking property transactions in Leicestershire. Technically, the website is built on WordPress, leveraging modern frameworks such as Bootstrap and Font Awesome, and integrates several plugins tailored for real estate listings and customer reviews. Hosting and DNS services are managed via Cloudflare, providing a reliable infrastructure. The site is mobile-optimized and includes SEO best practices, though accessibility features are basic. Analytics and marketing tools such as Google Analytics, Google Tag Manager, and Facebook SDK are implemented, alongside a cookie consent mechanism via CookieYes. From a security perspective, the site enforces HTTPS and uses Cloudflare DNS, but lacks explicit security headers and publicly available security or incident response policies. Forms include reCAPTCHA to mitigate spam. No critical vulnerabilities or exposed sensitive data were detected. WHOIS data confirms domain legitimacy with consistent registration details and appropriate domain age. Overall, the website demonstrates a solid business presence with good technical implementation and moderate security posture. However, improvements in privacy compliance documentation and security policy transparency are recommended to enhance trust and regulatory adherence.

-
70
65
100
15
100
2
realestatelettingspropertyleicestershireestateagents+2 more
WordPressBootstrap 5.1.3Font Awesome 5 and 6jQuery 3.5.1+7
2026-07-01T07:24:12.144Z
county-vets.co.uk favicon

County Vets

county-vets.co.uk

41
HealthcareUnited KingdomsmallHIGH

County Vets is a well-established veterinary practice based in Ayrshire, UK, providing comprehensive veterinary services for small animals, farm animals, and horses. The business operates two surgeries in Maybole and Ayr, offering a wide range of diagnostics, treatments, and health plans tailored to the needs of their clients. Their market position is that of a trusted local mixed veterinary practice with a clear focus on quality care and client service. Technically, the website is built on WordPress using modern technologies such as Bootstrap 4, jQuery, and FontAwesome. It employs Google reCAPTCHA v3 for form security and enforces HTTPS, ensuring secure communications. The site is moderately performant, mobile-optimized, and has good SEO and accessibility basics, though there is room for improvement in security headers and privacy compliance. From a security perspective, the site demonstrates good practices with HTTPS and anti-bot measures but lacks formal security policies, incident response information, and cookie consent mechanisms, which are important for GDPR compliance. No vulnerabilities or suspicious content were detected, and the domain registration data supports the legitimacy of the business. Overall, the website is professional, trustworthy, and serves its target audience effectively. Strategic improvements in privacy compliance and security headers would enhance its security posture and regulatory adherence.

57
65
-
60
35
25
2
veterinaryhealthcarepetsfarmanimalsequine+2 more
WordPressPHPjQueryBootstrap+3
2026-07-01T07:09:15.548Z
labosport.com favicon

Labosport Group

labosport.com

61
OtherN/amediumMEDIUM

Labosport Group is an established organization specializing in research, testing, and certification of sports surfaces and equipment, recognized as a FIFA Research Institute. Founded in 1993, the company offers consulting, testing services, training, and certification to improve sports surface safety and performance. The website targets sports industry professionals and related stakeholders globally, supporting multiple languages to cater to an international audience. The business model revolves around providing expert services and certifications in the sports surface domain, positioning Labosport as a trusted authority in this niche market. Technically, the website is built on WordPress 7.0 with a modern tech stack including jQuery, various plugins for SEO, translation (Weglot), marketing (Brevo/Sendinblue), push notifications (WonderPush), and analytics (Google Analytics, Snitcher). The site demonstrates good mobile optimization, SEO practices, and moderate performance. Hosting details are limited but the domain is registered with a reputable registrar (Gandi SAS). From a security perspective, the site uses HTTPS and has domain transfer protection enabled, but lacks DNSSEC and security headers. Anti-spam measures are in place via CleanTalk. No explicit privacy, cookie, or security policies are published, which is a compliance gap. No incident response or vulnerability disclosure information is available. Overall, the security posture is moderate but could be improved with better policy transparency and DNS security. The overall risk assessment is low to moderate with recommendations to enhance privacy compliance, enable DNSSEC, implement security headers, and publish clear security and incident response policies. These improvements will strengthen trust and regulatory compliance while maintaining the company’s professional online presence.

100
75
57
75
17
50
30
sportsresearchtestingcertificationfifa+4 more
WordPress 7.0jQuery 3.7.1Slider Hero Pro pluginCleanTalk Anti-Spam+6
2026-06-30T07:02:31.932Z
rostoncastings.co.uk favicon

Roston Castings

rostoncastings.co.uk

51
ManufacturingUnited KingdommediumMEDIUM

Roston Castings is a UK-based specialist aluminium casting foundry with over 60 years of experience supplying high-quality aluminium castings to automotive, aerospace, agriculture, and engineering industries. The company maintains a strong market position supported by ISO9001 certification and long-term partnerships with high-profile manufacturers. Their key services include design, toolmaking and CNC machining, and gravity die casting. The website reflects a professional and consistent brand image targeting B2B customers in technical manufacturing sectors. Technically, the website is built on WordPress using modern plugins such as Elementor and Slider Revolution, with good SEO and mobile optimization. The presence of Google Analytics and Tag Manager indicates moderate user tracking, balanced with GDPR-compliant cookie consent mechanisms. The site is served over HTTPS with no detected blocking or WAF interference, indicating a mature digital infrastructure. Security posture is solid with HTTPS, cookie consent, and reCAPTCHA integration, though explicit security headers and incident response policies are not publicly documented. No vulnerabilities or exposed sensitive data were found. The domain registration is consistent with the business history, registered since 1998 with a reputable UK registrar. Overall, the website presents a trustworthy and professional front for Roston Castings, with good compliance and security practices. Strategic improvements could include publishing a dedicated security policy, incident response contacts, and enhancing security headers to further strengthen the security posture.

85
70
47
20
15
88
2
manufacturingaluminiumcastinggravitydiecastingiso9001ukfoundry+2 more
WordPressPHPJavaScriptjQuery+8
2026-06-29T07:24:20.544Z
platingbarrels.com favicon

Eagle Engineering (Telford) Ltd

platingbarrels.com

60
ManufacturingUnited KingdomsmallMEDIUM

Eagle Engineering (Telford) Ltd is a UK-based specialist manufacturer and supplier of high-quality electro-plating barrels, plating barrel units, and related equipment. With over 20 years of industry experience, the company serves a global industrial electroplating market, emphasizing innovative design and durable materials. Their business model focuses on B2B manufacturing and equipment supply, supported by ISO 9001 certification and positive customer testimonials. The website reflects a professional and consistent brand presence, targeting industrial clients worldwide. Technically, the website is built on WordPress using the Divi theme, incorporating common plugins such as Contact Form 7, Formidable Forms, and Google Analytics for tracking. The site is moderately performant, mobile-optimized, and SEO-friendly with structured data and meta tags. Security measures include HTTPS enforcement, Google reCAPTCHA on forms, and cookie consent mechanisms, though additional security headers and explicit security policies could enhance the posture. The security posture is solid with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, GDPR consent, and secure data collection forms. The WHOIS data confirms domain legitimacy with consistent registration details and appropriate domain age matching the business history. Overall, the website presents a trustworthy, professional, and compliant digital presence for Eagle Engineering, with recommendations to strengthen security headers and incident response transparency to further improve risk management.

70
57
100
70
17
15
65
manufacturingplatingbarrelselectroplatingindustrialequipmentiso9001+2 more
WordPressDivi ThemejQueryGoogle Analytics+5
2026-06-29T07:20:32.996Z
dasktimber.co.uk favicon

Dask Timber Products Ltd

dasktimber.co.uk

50
ManufacturingUnited KingdomsmallMEDIUM

Dask Timber Products Ltd is a small, family-run manufacturing business specializing in high-quality timber joinery products serving the UK, Northern Ireland, and Ireland markets. With a claimed 40 years of experience, the company offers a diverse product range including conservation, contemporary, renovation timber products, staircases, conservatories, and secondary glazing. The website reflects a professional and consistent brand presence with clear contact information and social media integration. Technically, the website is built on WordPress using the Divi theme, incorporating common plugins such as Yoast SEO and Contact Form 7. It uses Google Analytics and Google Tag Manager for tracking. The site is mobile-optimized and has good SEO practices, though accessibility features are basic. Performance is moderate with no major technical issues detected. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks important security headers and explicit privacy or cookie policies. No vulnerability disclosure or incident response information is provided. The WHOIS data is unavailable and indicates domain registration issues, which raises concerns about domain legitimacy despite the professional website content. Overall, the website is functional and professional but would benefit from enhanced security practices, clear privacy compliance documentation, and verification of domain registration details to improve trustworthiness and compliance.

80
60
70
-
53
17
-
timberjoineryconservationrenovationstaircases+5 more
Google AnalyticsGoogle Tag ManagerYoast SEOWordPress+2
2026-06-29T07:14:41.356Z
surescaff.co.uk favicon

SureScaff Limited

surescaff.co.uk

34
OtherUnited KingdomsmallHIGH

SureScaff Limited is a small family-owned business specializing in providing safe access scaffolding and working platforms primarily serving North Wales and the North West of England. The company targets local builders, roofers, decorators, construction companies, and local authorities, positioning itself as a leading supplier in its regional market. The website reflects a professional service provider with clear contact details and a focus on safety and reliability in scaffolding services. Technically, the website is built on WordPress using common plugins such as Yoast SEO and Contact Form 7, with a moderate performance profile and good mobile optimization. The hosting is provided by Heart Internet Limited, a reputable registrar and hosting provider. The site uses HTTPS but lacks advanced security headers and privacy compliance features, indicating room for improvement in security and regulatory adherence. From a security perspective, the site has basic protections with no visible vulnerabilities or WAF blocking. However, the absence of privacy and cookie policies and missing security headers reduce its compliance posture. There is no evidence of incident response or vulnerability disclosure mechanisms. Overall, the security posture is moderate but could be enhanced with standard best practices. The overall risk assessment is moderate with a recommendation to implement privacy and cookie policies, improve security headers, and establish incident response contacts. These steps will enhance trust, compliance, and security maturity, supporting the company’s professional image and business continuity.

40
47
-
60
35
15
2
scaffoldingconstructionworkingplatformsnorthwalessafeaccess
WordPressPHPjQueryYoast SEO plugin+4
2026-06-29T07:07:49.495Z