Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

151882
Websites
130
Industries
113
Countries
52
Avg Score
Page 482 of 636|Showing 24051-24100 of 31753
metrogas.co.nz favicon

Metro Gas Ltd

metrogas.co.nz

64
EnergyNew ZealandsmallMEDIUM

Metro Gas Ltd operates a regional LPG cylinder delivery and swap service primarily serving residential, hospitality, and commercial customers in Auckland and Hamilton, New Zealand. The company emphasizes convenience by delivering LPG cylinders directly to customers' doors, replacing the traditional gas bottle swap at service stations. Their website reflects a professional and customer-focused approach with clear service descriptions and easy navigation. Technically, the website employs modern web technologies including Vue.js, Google reCAPTCHA, and Google Analytics, ensuring a responsive and user-friendly experience. The site is well-optimized for mobile devices and demonstrates good SEO practices. Security is robust with HTTPS enforced and secure payment processes, although some security headers are missing and no explicit cookie consent mechanism is present. From a security perspective, the site shows good maturity with no visible vulnerabilities or exposed sensitive data. However, the absence of WHOIS data limits domain registration trust analysis, and no formal security or incident response policies are published. Overall, the site is trustworthy and professional but could improve transparency and compliance by adding cookie consent and security policy information. The overall risk is moderate with recommendations to enhance security headers, implement cookie consent, and publish vulnerability disclosure or incident response details to strengthen trust and compliance.

75
53
2
70
72
60
100
lpggasdeliveryenergynewzealandmetrogas+3 more
Google reCAPTCHAGoogle FontsVue.jsSwiper.js+2
2025-07-07T07:49:50.156Z
maritimemuseum.co.nz favicon

Tātaki Auckland Unlimited

maritimemuseum.co.nz

69
TransportationNew ZealandmediumMEDIUM

The New Zealand Maritime Museum, operated under Tātaki Auckland Unlimited, is a prominent cultural institution in Auckland, New Zealand, dedicated to maritime heritage. The museum offers a variety of services including harbour sailings on heritage vessels, exhibitions, educational programs, and an extensive online collection. It targets a broad audience including families, tourists, maritime enthusiasts, and educational groups. The museum holds a strong market position as a key maritime attraction in the region. Technically, the website is built using modern technologies such as React, integrated with multiple analytics and tracking tools including Google Analytics, Hotjar, and Microsoft Clarity. It employs a cookie consent mechanism powered by Securiti.ai and uses reCAPTCHA for form security. The site is mobile-optimized, accessible, and SEO-friendly, providing a good user experience. From a security perspective, the website enforces HTTPS and uses several security best practices, including secure forms and cookie consent. While explicit security headers were not fully confirmed, the overall SSL configuration is good, and no vulnerabilities were detected in the visible content. Privacy compliance is strong with clear privacy and cookie policies, and contact information is readily available. Overall, the website demonstrates a high level of professionalism, trustworthiness, and compliance with privacy regulations. The lack of publicly available WHOIS data is consistent with .nz domain privacy policies and does not detract from the legitimacy of the institution. Strategic recommendations include enhancing security headers and continuous monitoring of third-party scripts to maintain security posture.

60
68
2
85
77
70
100
maritimemuseumaucklandmuseumharboursailingsexhibitions+3 more
ReactGoogle Tag ManagerGoogle AnalyticsHotjar+4
2025-07-07T07:49:15.081Z
aiatsis.gov.au favicon

Australian Institute of Aboriginal and Torres Strait Islander Studies

aiatsis.gov.au

63
GovernmentAustraliamediumMEDIUM

The Australian Institute of Aboriginal and Torres Strait Islander Studies (AIATSIS) is Australia's sole national institution dedicated to the history, culture, and heritage of Aboriginal and Torres Strait Islander peoples. It operates as a government-funded entity providing extensive research, educational resources, and cultural heritage services. The website reflects a strong market position as a trusted custodian and leader in Indigenous Australian studies, targeting researchers, educators, Indigenous communities, and the general public. Key services include family history research support, collection access, educational curriculum resources, and cultural heritage repatriation programs. Technically, the website is built on Drupal 10 with modern JavaScript libraries and integrates Google Analytics, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a moderate performance profile. Hosting details are not explicitly stated but the domain is managed by the Australian Department of Finance with DNS via netregistry.net. From a security perspective, the site enforces HTTPS with strong SSL configuration and uses Content Security Policy nonces to mitigate script injection risks. However, DNSSEC is not enabled, and there is no visible cookie consent mechanism or published vulnerability disclosure policy. The WHOIS data confirms the domain is registered to a legitimate government entity with domain status protections, enhancing trustworthiness. Overall, AIATSIS's website is professional, content-rich, and secure, with minor gaps in privacy compliance and vulnerability disclosure. It serves as a reliable digital platform for Indigenous cultural and research engagement in Australia.

70
53
17
65
42
75
100
aboriginaltorresstraitislanderindigenousresearcheducation+3 more
Drupal 10jQuerySlick CarouselGoogle Tag Manager+3

Partner Domains:

shop.aiatsis.gov.au
partner
2025-07-07T07:49:05.059Z
A

Australian Government Department of Health, Disability and Ageing

health.gov.au

57
GovernmentAustraliaenterpriseMEDIUM

The Australian Government Department of Health, Disability and Ageing operates as the national authority for health and aged care policy and services in Australia. The website serves as a comprehensive resource for public health information, government programs, and policy updates, targeting a broad audience including the general public, health professionals, and industry stakeholders. The department holds a strong market position as a government entity with authoritative content and trusted branding. Technically, the website is built on Drupal CMS with govCMS, leveraging modern web technologies including Google Tag Manager, Google Analytics, and Facebook Pixel for analytics and marketing. The site demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a high-quality user experience. Hosting and infrastructure appear robust and aligned with government standards. From a security perspective, the site enforces HTTPS and follows best practices with secure forms and privacy policies. While explicit security headers are not visible in the HTML, it is likely they are configured server-side. No vulnerabilities or suspicious activities were detected. Privacy compliance is strong with clear policies and a vulnerability disclosure program. Overall, the website presents a low risk profile with high trustworthiness and professionalism. It effectively supports the department's mission to provide health information and services to Australians. Strategic recommendations include verifying security headers and maintaining up-to-date CMS components to sustain security posture.

-
58
35
92
-
85
100
governmenthealthagedcarepublichealthaustralia+3 more
Drupal 9Drupal 10govCMSGoogle Tag Manager+3
2025-07-07T07:49:00.050Z
powersystemstoday.com favicon

PowerSystemsToday

powersystemstoday.com

71
EnergyUnited StatesmediumMEDIUM

PowerSystemsToday.com is a specialized online marketplace focused on new and used power systems and generators, serving a niche market within the energy sector. It offers a comprehensive platform for buyers and sellers, including dealer portals and VIP services, and is part of the larger Sandhills Global family, which lends credibility and operational support. The website is well-structured with clear navigation, modern design, and up-to-date content, targeting both individual and business customers seeking power solutions. Technically, the site leverages modern web technologies such as React and Material-UI, integrates Google Analytics and Tag Manager for tracking, and employs HTTPS with strong security headers, indicating a mature digital infrastructure. Mobile optimization and accessibility are well addressed, enhancing user experience across devices. From a security perspective, the site demonstrates good practices including secure forms with anti-CSRF tokens and cookie consent mechanisms aligned with GDPR. However, it lacks publicly available security policies and incident response contacts, which are recommended for enhanced transparency and trust. The absence of WHOIS data is a notable anomaly but does not detract significantly from the overall legitimacy given the strong brand association. Overall, PowerSystemsToday.com presents a low-risk profile with a solid business foundation and technical implementation. Strategic improvements in security transparency and WHOIS data availability would further strengthen trust and compliance.

30
100
17
95
57
85
100
powersystemsgeneratorsenergymarketplaceindustrialequipment+1 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

www.sandhills.com
parent
vip.powersystemstoday.com
subsidiary

+1 more partners

2025-07-07T06:45:32.512Z
motorsportsuniverse.com favicon

MotorSportsUniverse

motorsportsuniverse.com

69
TransportationUnited StatesmediumMEDIUM

MotorSportsUniverse.com operates as a specialized online marketplace dedicated to the buying and selling of new and used powersports and motorsports vehicles. The platform caters to enthusiasts and dealers by providing a comprehensive database of vehicles including ATVs, UTVs, motorcycles, dirt bikes, and snowmobiles. It is part of the Sandhills Global family, a well-established company with a broad portfolio of industry-specific marketplaces, enhancing its market credibility and reach. Technically, the website leverages modern web technologies such as React and Material-UI, ensuring a responsive and user-friendly experience across devices. The site integrates Google Analytics and Tag Manager for data-driven insights and marketing optimization. SEO and accessibility practices are well implemented, contributing to good performance and discoverability. From a security perspective, the site enforces HTTPS and includes standard security headers, CSRF protections, and cookie consent mechanisms, reflecting a mature security posture. However, the absence of a publicly available security policy and incident response information indicates areas for improvement. The WHOIS data is notably missing or unavailable, which raises some concerns about domain registration transparency but is partially mitigated by the professional presentation and association with Sandhills Global. Overall, MotorSportsUniverse.com presents a solid, trustworthy platform with good technical and security foundations. Strategic enhancements in transparency around security policies and domain registration details would further strengthen trust and compliance.

20
100
17
95
57
85
100
motorsportspowersportsvehiclesmarketplaceatvs+5 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

sandhills.com
parent
tractorhouse.com
sister

+3 more partners

2025-07-07T06:45:12.438Z
utilitytrailerstoday.com favicon

UtilityTrailersToday

utilitytrailerstoday.com

67
TransportationUnited StatesmediumMEDIUM

UtilityTrailersToday.com is a specialized online marketplace focused on the buying and selling of new and used utility trailers. It offers a broad range of trailer types including cargo, dump, flatbed, car haulers, and more, catering to buyers and sellers in the transportation and equipment sectors. The platform is operated by Sandhills Global, a reputable company with a strong presence in equipment marketplaces, which lends credibility and market positioning to the site. The website provides detailed listings, search capabilities, dealer portals, and financing options, positioning itself as a comprehensive resource in its niche. From a technical perspective, the website employs modern web technologies such as React and Material UI, ensuring a responsive and user-friendly experience. It integrates Google Tag Manager and Google Analytics for tracking and marketing purposes. The site is well-structured with good SEO and accessibility practices, though some improvements could be made in privacy and security policy disclosures. Security-wise, the site uses HTTPS and has some security best practices in place, but lacks explicit security headers like Content-Security-Policy and X-Frame-Options. There is no visible privacy or cookie policy, which is a compliance gap. The WHOIS data is unavailable, which is unusual but the backing by Sandhills Global mitigates trust concerns. Overall, the security posture is moderate with room for improvement. The overall risk assessment is moderate; the site is professionally operated and technically sound but should enhance transparency around privacy, cookie usage, and security policies. Strategic recommendations include adding comprehensive privacy and cookie policies, implementing security headers, and publishing a vulnerability disclosure or security.txt file to improve trust and compliance.

20
100
17
80
57
80
100
utilitytrailersequipmentmarketplacetransportationonlinesalessandhillsglobal
ReactMaterial UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

www.sandhills.com
parent
vip.utilitytrailerstoday.com
subsidiary
2025-07-07T06:45:07.429Z
rentalyard.com favicon

RentalYard

rentalyard.com

69
TransportationUnited StatesmediumMEDIUM

RentalYard.com operates as a specialized online marketplace and marketing platform focused on the rental and leasing of heavy equipment, farm machinery, trucks, trailers, and attachments. The platform targets contractors, fleet operators, equipment dealers, and rental companies, providing a robust inventory and tools to facilitate equipment rental transactions. It is positioned as a niche player within the transportation sector, supported by its parent company Sandhills Global, which lends credibility and operational support. Technically, the website leverages modern web technologies including React and Material-UI, with integrations for Google Analytics and Tag Manager for marketing and analytics purposes. The site is well-structured, mobile-optimized, and employs standard SEO and accessibility practices, though accessibility could be further enhanced. Performance is moderate, with a professional design and clear navigation. From a security perspective, the site enforces HTTPS with strong SSL configurations and includes security headers such as Content Security Policy and Strict-Transport-Security. Forms use CSRF tokens, and no sensitive data is exposed in the HTML. However, explicit security policies and incident response information are not published, and no vulnerability disclosure or security.txt files are present, which are areas for improvement. The domain WHOIS data is notably absent, which raises concerns about domain registration transparency and trustworthiness. Despite this, the website content and business association with Sandhills Global suggest legitimacy. Privacy and cookie policies are present with consent mechanisms, indicating compliance with GDPR and related regulations. Overall, RentalYard.com is a professionally managed and secure platform with a clear business focus and good technical implementation. Addressing the WHOIS transparency and publishing detailed security policies would further strengthen trust and compliance.

20
100
17
95
57
85
100
equipmentrentalconstructionequipmentfarmequipmenttruckrentaltrailers+3 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

sandhills.com
parent
sandhillscloud.com
partner

+1 more partners

2025-07-07T06:44:57.409Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

56
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z
getinstantly.app favicon

Instantly: receive notifications from your favourite creators

getinstantly.app

71
TechnologyN/asmallMEDIUM

Instantly is a technology-focused mobile application platform that enables users to receive notifications from their favourite content creators. The website serves primarily as a landing page promoting the app with download links for iOS and Android platforms. The business model centers around providing a notification delivery service to a general audience interested in creator content updates. The site is professionally designed with consistent branding and good mobile optimization, though it lacks detailed company information and contact channels. Technically, the website employs standard modern web technologies including JavaScript, CSS, Google Analytics, and Facebook Pixel for tracking and marketing purposes. The site is served over HTTPS with anonymized IP tracking enabled in analytics, indicating a baseline security posture. However, the absence of security headers and published security policies suggests room for improvement in security maturity. From a security perspective, the site shows no signs of vulnerabilities or malicious content but lacks comprehensive privacy compliance features such as cookie consent mechanisms and GDPR explicit indicators. No incident response or vulnerability disclosure information is available, which could be a concern for transparency and user trust. The domain registration is privacy protected, which is common for small tech services but reduces public trust signals. Overall, the website is functional and professional but would benefit from enhanced security practices, clearer privacy compliance, and more transparent business contact information to improve trustworthiness and compliance posture.

90
68
2
75
75
80
100
mobileappnotificationscreatorstechnologyprivacy+1 more
Google AnalyticsFacebook PixelJavaScriptCSS
2025-07-07T06:42:21.618Z
forsythbarr.co.nz favicon

Forsyth Barr Limited

forsythbarr.co.nz

71
FinanceNew ZealandlargeMEDIUM

Forsyth Barr Limited is a well-established New Zealand owned investment firm with over 85 years of history, providing a comprehensive range of investment services including sharebroking, portfolio management, research, and investment banking. The company operates through 25 offices nationwide and targets New Zealand investors seeking professional and personalized investment advice. Their business model focuses on managed portfolios, transactional services, and digital investment platforms, supported by award-winning research and a strong market presence. The website reflects a mature, professional financial services provider with consistent branding and trust indicators such as affiliations with NZX and multiple partner entities. Technically, the website employs modern web technologies including React, Bootstrap, and various analytics and marketing tools such as Google Analytics, Facebook Pixel, and Intercom. The site is mobile-optimized and accessible, with good SEO practices and a likely CMS backend (Umbraco). Performance is moderate, with room for improvement in loading speed and explicit security header implementation. Security posture is strong with HTTPS enforced and secure login portals, though explicit security headers and incident response information are not publicly visible. Privacy compliance is partial, with a comprehensive privacy policy present but lacking a visible cookie consent mechanism. The absence of WHOIS data for the domain limits full trust verification, but the overall digital footprint and business information strongly support legitimacy. Overall, Forsyth Barr's website is a professional, secure, and trustworthy platform for investment services in New Zealand, with recommendations to enhance privacy compliance and security transparency to further strengthen user trust and regulatory adherence.

85
53
17
75
77
80
100
investmentfinancenewzealandsharebrokingportfoliomanagement+2 more
JavaScriptjQuery UI AutocompleteGoogle Tag ManagerGoogle Analytics+4

Partner Domains:

www.summer.co.nz
partner
www.octagonasset.co.nz
partner

+3 more partners

2025-07-07T06:42:11.602Z
davenportslaw.co.nz favicon

Davenports Law

davenportslaw.co.nz

53
Real EstateNew ZealandmediumMEDIUM

Davenports Law is a professional law firm based in North Shore Auckland, New Zealand, specializing in Trust Law, Wills and Estate Law, Commercial Law, and Property Law. The firm targets individuals and businesses seeking tailored legal advice and ongoing support. Their website reflects a well-established regional presence with a medium-sized team and a strong focus on client collaboration and guidance. The site features detailed legal articles, team profiles, testimonials, and affiliations with reputable legal organizations, reinforcing their credibility. Technically, the website employs modern JavaScript libraries such as jQuery, Slick Carousel, and integrates Google Tag Manager, Google Analytics, Facebook Pixel, and LinkedIn Insight Tag for analytics and marketing. The site is mobile-optimized with good SEO practices and a professional design, though some accessibility features are basic. Security-wise, the site uses HTTPS and Google reCAPTCHA for form protection but lacks several recommended security headers, which could be improved to enhance defense against common web attacks. The WHOIS data for the domain is unavailable, which raises some concerns about domain registration transparency. However, the website content and professional presentation strongly suggest legitimacy. No signs of malware or phishing were detected. Privacy policy is present and comprehensive, but no cookie consent mechanism was found despite tracking technologies in use. Overall, the site presents a low risk but would benefit from enhanced security headers and clearer cookie consent to improve compliance and trust. Strategic recommendations include implementing additional security headers, establishing a cookie consent mechanism, and verifying domain registration details to improve trustworthiness and compliance.

35
53
17
80
72
70
20
lawlegaladvicetrustlawpropertylawcommerciallaw+3 more
jQueryjQuery UISlick CarouselGoogle Tag Manager+4
2025-07-07T06:41:56.569Z
thebrandery.co.nz favicon

The Brandery

thebrandery.co.nz

60
OtherNew ZealandsmallMEDIUM

The Brandery is a small creative agency based in Auckland, New Zealand, specializing in graphic design, video production, animation, website design, and branding services. The company targets marketers and businesses across New Zealand and Australia, offering outsourced creative production to help clients regain workday efficiency. The website presents a professional image with a clear portfolio and client logos, indicating a solid market position among startups and industry leaders. Technically, the site is built on Squarespace, leveraging modern web technologies and integrating Google Analytics and Tag Manager for tracking. While the site is mobile-optimized and performs moderately well, there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enforced, but lacks advanced security headers such as HSTS and CSP, which are recommended to enhance protection. Privacy compliance is basic, with no visible cookie consent mechanisms or comprehensive GDPR indicators. The absence of WHOIS data is a concern, reducing domain trustworthiness, though the website content suggests legitimacy. Overall, the site scores well in business credibility and content quality but should address security and privacy gaps to improve trust and compliance.

35
53
2
85
62
65
100
creativeagencybrandinggraphicdesignvideoproductionanimation+2 more
SquarespaceGoogle AnalyticsGoogle Tag ManagerTypekit Fonts+1
2025-07-07T06:40:51.452Z
appropo.io favicon

Appropo Limited

appropo.io

58
HospitalityNew ZealandsmallMEDIUM

Appropo Limited operates a specialized SaaS platform focused on the hospitality sector in New Zealand, offering online ordering, payments, loyalty programs, and customer segmentation tools. The company has an established market presence since 2014, serving over 200 cafes, bars, and restaurants. Their platform integrates with notable partners such as DoorDash, Mailchimp, Windcave, and Xero, enhancing their service ecosystem. The website reflects a professional and consistent brand image with good content quality and user experience tailored for hospitality businesses. Technically, the website employs modern web technologies including Alpine.js for interactivity and Google Analytics for user tracking. Hosting appears to be on AWS infrastructure, with DNS managed via AWS nameservers. The site is mobile optimized and SEO friendly, though accessibility features are basic. Security posture is adequate with HTTPS enforced and domain transfer protections in place, but lacks DNSSEC and security headers, which are recommended for enhanced protection. From a security and compliance perspective, the site lacks explicit privacy cookie consent mechanisms and terms of service documentation, which are important for GDPR and general privacy compliance. No incident response or vulnerability disclosure policies are publicly available. The WHOIS data is consistent with the business claims, showing a legitimate and stable domain registration. Overall, the risk profile is moderate with room for improvement in privacy compliance and security hardening. Strategically, Appropo should prioritize implementing cookie consent, publishing clear terms and security policies, enabling DNSSEC, and adding security headers to strengthen trust and compliance. These steps will enhance their security posture and align with regulatory expectations, supporting continued growth in the competitive hospitality technology market.

15
53
2
75
67
75
100
engagementanalyticscustomerloyaltybrand+5 more
HTML5CSS3JavaScriptGoogle Analytics+1

Partner Domains:

vouchers.appropo.io
service
mailchimp.com
partner

+3 more partners

2025-07-07T06:39:46.339Z
britishfires.com.au favicon

British Fires Australia & New Zealand

britishfires.com.au

48
RetailAustraliamediumHIGH

British Fires Australia & New Zealand is a retail business specializing in fireplace products, serving the Australian and New Zealand markets. The company has an established online presence with a domain registered since 2000, indicating long-term market participation. The website uses WordPress CMS with the Divi theme and integrates common marketing and analytics tools such as Google Analytics and Facebook Pixel. The site is professionally designed with good content quality and mobile optimization, targeting general consumers interested in home heating and fireplace products. However, the website lacks explicit privacy and cookie policies, which impacts its privacy compliance score. From a technical perspective, the website employs modern web technologies and is hosted likely on SiteGround, with moderate performance and good SEO optimization. Security posture is adequate with HTTPS enabled, but the absence of security headers and DNSSEC reduces the overall security score. No forms or contact information were detected in the provided content, limiting direct user engagement channels. The security evaluation shows no critical vulnerabilities or WAF blocking, but improvements are recommended in implementing security headers, privacy policies, and cookie consent mechanisms to enhance compliance and trust. The domain registration data aligns well with the website's business claims, supporting legitimacy and trustworthiness. Overall, British Fires Australia & New Zealand presents a credible and professional online presence with room for improvement in privacy compliance and security best practices to strengthen user trust and regulatory adherence.

15
53
2
85
72
75
-
fireplaceretailaustralianewzealandhomeheating+3 more
jQueryGoogle AnalyticsFacebook PixelWeglot+3
2025-07-07T06:39:21.290Z
glaifa-lichtreclame.com favicon

Glaifa Lichtreclame

glaifa-lichtreclame.com

49
RetailNetherlandsmediumHIGH

Glaifa Lichtreclame is a well-established Dutch company specializing in the production and installation of light advertising, facade signage, and related products for businesses. With over 75 years of experience and recognized certifications such as installQ and membership in Techniek Nederland, Glaifa positions itself as a trusted partner for companies seeking high-quality signage solutions. Their website reflects a professional and comprehensive digital presence, offering detailed service descriptions, project showcases, and multiple contact channels including forms protected by Google reCAPTCHA. Technically, the website employs modern web technologies including Mapbox for mapping, Google Tag Manager, Google Analytics, Microsoft Clarity, Hotjar, and ClickCease for analytics and security. The site is mobile-optimized with good SEO practices and a clean, consistent design. Security measures include HTTPS enforcement and spam protection on forms, though explicit security headers are not detected, indicating room for improvement. From a security and compliance perspective, the site maintains privacy and cookie policies with consent mechanisms, aligning with GDPR requirements. However, the lack of WHOIS data for the domain raises questions about domain registration transparency, though the professional nature of the site and presence of valid contact information mitigate immediate concerns. No critical vulnerabilities or adult content are present, and the site is safe for general audiences. Overall, Glaifa Lichtreclame demonstrates a strong business and technical foundation with minor areas for security enhancement and domain registration verification. Strategic recommendations include implementing security headers, clarifying domain registration status, and maintaining rigorous third-party script audits to ensure ongoing security and compliance.

20
68
2
60
72
70
20
lichtreclamegevelreclamegevellettersreclamezuilenlichtbakken+4 more
Mapbox GL JSGoogle Tag ManagerGoogle AnalyticsMicrosoft Clarity+4

Partner Domains:

publima.be
partner
2025-07-07T05:36:42.910Z
F

Federal Reserve Bank of St. Louis

stlouisfed.org

53
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of St. Louis operates as one of the 12 regional Reserve Banks within the Federal Reserve System, serving a critical role in the U.S. central banking framework. The website provides extensive economic resources, data tools, research publications, and educational materials targeted at economists, financial institutions, educators, and the general public. It maintains a strong market position as an authoritative source for economic data and Federal Reserve information. Technically, the website employs a modern technology stack including Bootstrap 4, jQuery, Google Tag Manager, and analytics tools such as Google Analytics and Crazy Egg. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes several security best practices. While some security headers are not explicitly detected, the overall posture is strong with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance. Overall, the website is highly professional, trustworthy, and aligned with the Federal Reserve's mission. The lack of WHOIS data is mitigated by the authoritative content and branding. The site poses low risk and serves as a reliable resource for its audience.

-
58
25
70
-
85
100
federalreserveeconomicdatabankingresearcheducation+1 more
jQuery 3.7.1Bootstrap 4Google Tag ManagerGoogle Analytics+3

Partner Domains:

fred.stlouisfed.org
partner
fraser.stlouisfed.org
partner

+2 more partners

2025-07-07T05:34:17.366Z
C

Cities for Financial Empowerment Fund

cfefund.org

60
GovernmentUnited StatesmediumMEDIUM

Cities for Financial Empowerment Fund (CFE Fund) is a US-based non-profit organization founded in 2011 that supports mayors and local governments across the country by providing grant funding and strategic assistance to embed financial empowerment initiatives in municipal operations. The organization has a strong market position with partnerships in approximately 145 cities, directly supporting over 900,000 residents. Their key services include grant distribution, program development, and impact reporting focused on improving financial stability for city residents. Technically, the website is built on WordPress with a modern tech stack including Gravity Forms for data collection, Google Analytics for tracking, and Cloudflare for DNS management. The site demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. The infrastructure is typical for a mid-sized non-profit organization. From a security perspective, the site uses HTTPS and CAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No exposed sensitive data or vulnerabilities were detected in the HTML content. Privacy compliance is basic, with a privacy policy and terms of service present but no cookie consent mechanism. Contact information is available, but no dedicated security policy or incident response contacts were found. Overall, the website is professional, trustworthy, and safe for general audiences. The security posture is adequate but could be improved with additional DNS and header configurations. The organization’s domain registration is privacy protected, consistent with non-profit practices, and the domain age aligns with the organization's history.

30
53
17
60
75
65
100
non-profitfinancialempowermentgovernmentcitiesgrants+1 more
WordPressGravity FormsGoogle AnalyticsCloudflare DNS+6
2025-07-07T05:34:12.358Z
lexology.com favicon

Law Business Research

lexology.com

70
MediaN/alargeMEDIUM

Lexology is a leading global platform delivering comprehensive international legal updates, analysis, and insights primarily targeted at law firms and in-house counsel. The platform offers a wide range of services including legal newsfeeds, research hubs, compliance calendars, masterclasses, and analytics tools, positioning itself as a key resource in the legal media sector. The website is professionally designed with consistent branding and good content quality, supporting its market position as a trusted legal intelligence provider. Technically, Lexology employs modern web technologies such as React, Google Analytics, Hotjar, and CookiePro for tracking and consent management, ensuring a mature digital infrastructure. Security posture is strong with HTTPS enforcement and standard security headers, although explicit security policies and incident response contacts are not publicly disclosed. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The absence of WHOIS data limits full verification of domain legitimacy, but the overall professional presentation and trust signals support a positive risk assessment. Strategic recommendations include publishing security policies, incident response contacts, and enhancing accessibility to further strengthen trust and compliance.

40
95
2
85
75
85
100
legalnewsmediacomplianceanalytics+3 more
ReactjQueryFontAwesomeGoogle Analytics+5
2025-07-07T05:33:47.313Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

59
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
wiley.law favicon

Wiley Rein LLP

wiley.law

69
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z
M

Mitchell Silberberg & Knupp LLP

msk.com

56
MediaUnited StateslargeMEDIUM

Mitchell Silberberg & Knupp LLP is a well-established full-service law firm with deep roots in the Los Angeles entertainment industry since 1908. The firm has expanded nationally with offices in Los Angeles, New York, and Washington, D.C., offering a broad range of legal services including intellectual property, litigation, labor and employment, corporate law, immigration, regulatory, tax, and trusts & estates. The website reflects a professional and stable firm culture with a focus on creative legal advisory and business partnership. Technically, the website employs modern web technologies such as HTML5 video, JWPlayer, and integrates Google Analytics and Tag Manager for tracking. The site is moderately optimized for performance and mobile use, with good SEO practices evident in meta tags and structured content. Security posture is adequate with HTTPS implied, but lacks visible security headers and explicit privacy or cookie policies, which are areas for improvement. The absence of WHOIS data raises some concerns about domain registration transparency, though the website content and branding strongly support legitimacy. Overall, the site is professional and trustworthy but would benefit from enhanced privacy compliance and security best practices.

40
35
17
60
42
75
100
lawfirmlegalservicesentertainmentindustryintellectualpropertylitigation+3 more
jwplayer 7.0.0Google Tag ManagerGoogle AnalyticsHTML5 video+2
2025-07-07T05:32:27.159Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

67
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z