Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157333
Websites
130
Industries
113
Countries
52
Avg Score
Page 388 of 1064|Showing 19351-19400 of 53175
pillar.io favicon

Domains By Proxy, LLC

pillar.io

58
TechnologyUnited StatesmediumMEDIUM

Pillar.io is a SaaS platform focused on empowering social media creators, coaches, and digital marketers by providing an all-in-one link in bio tool that enables users to create, host, and sell digital products and services. The platform integrates marketing tools, AI assistants, and e-commerce capabilities to automate creator business operations and facilitate brand deals. With a user base exceeding 100,000 creators, Pillar positions itself as a comprehensive solution in the creator economy space. Technically, the website leverages modern web technologies including Webflow CMS, Google Tag Manager, TikTok and Facebook Pixels, PostHog analytics, and personalization tools like Intellimize. Hosting appears to be on AWS infrastructure with GoDaddy as the domain registrar. The site is mobile optimized and demonstrates good SEO and accessibility practices, though some accessibility features are basic. From a security perspective, the website enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, DNSSEC is not enabled, and no explicit security headers or policies are published. The site lacks visible privacy and cookie policies, which impacts privacy compliance scores. No vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, Pillar.io presents a professional and functional platform with moderate security and privacy compliance maturity. Strategic improvements in privacy disclosures, security headers, and DNS security would enhance trust and compliance.

30
53
2
55
67
80
100
creatortoolslinkinbioe-commercemarketingsaas+3 more
Webflow CMSGoogle Tag ManagerTikTok PixelFacebook Pixel+3
2025-10-12T17:48:25.580Z
motork.io favicon

MotorK

motork.io

62
TransportationN/amediumMEDIUM

MotorK is a SaaS software provider specializing in automotive management solutions tailored for car dealers, distributors, and manufacturers. The company offers a comprehensive suite of products including dealership websites, CRM and lifecycle management, vehicle management, traffic acquisition, and e-reputation tools. Positioned as a digital transformation enabler in the automotive sector, MotorK targets industry professionals seeking to enhance customer journeys and operational efficiency. The website reflects a mature digital presence with strong SEO and structured data, indicating a well-established market position since at least 2019. Technically, the website is built on WordPress with Elementor and integrates modern marketing and analytics tools such as Google Tag Manager, Google Analytics, Mautic, and Iubenda for privacy compliance. The site is mobile-optimized and performs moderately well, with good accessibility and SEO practices. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, alongside a comprehensive cookie consent mechanism. However, explicit security headers and dedicated security policies are absent, suggesting room for improvement in security posture. The security evaluation shows a solid baseline with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with GDPR-aligned cookie consent and privacy policies. The absence of WHOIS data due to privacy protection is typical for commercial entities and does not detract from the site's legitimacy, which is supported by professional content and multiple trust signals. Overall, the site presents a low-risk profile with recommendations to enhance security headers and publish incident response information. Strategically, MotorK should focus on formalizing security policies, implementing vulnerability disclosure mechanisms, and enhancing accessibility to maintain trust and compliance as it scales. The digital infrastructure is sound but could benefit from continuous security audits and modernization to sustain competitive advantage and protect customer data.

45
73
35
75
-
85
100
saasautomotivecrmdigitalizationcardealers+4 more
WordPressElementorYoast SEOGoogle Tag Manager+3

Partner Domains:

investors.motork.io
subsidiary
2025-10-12T17:48:20.295Z
kinzoo.com favicon

Kinzoo

kinzoo.com

54
TechnologyN/asmallMEDIUM

Kinzoo is a technology company specializing in safe and creative applications for children, focusing on secure communication and interactive content that fosters connection and creativity without exposure to ads or strangers. The company offers three main products: Kinzoo Messenger, Kinzoo Together, and Kinzoo Studio, each designed to provide a child-friendly digital experience. The website is well-designed, mobile-optimized, and features multiple positive testimonials and certifications from recognized child safety organizations, positioning Kinzoo as a trusted niche player in child-safe technology apps. Technically, the website leverages modern web technologies including Webflow CMS, Google Analytics, Google Tag Manager, Facebook Pixel, and Singular SDK for analytics and marketing. It employs HTTPS with strong security headers, cookie consent mechanisms, and multimedia content to engage users effectively. The site demonstrates good performance and accessibility standards. From a security perspective, the site shows good practices such as HTTPS enforcement and security headers, but lacks explicit privacy and terms of service pages, which are important for compliance and user trust. The absence of WHOIS data for the domain raises concerns about domain registration transparency, although the website content and certifications suggest legitimacy. Overall, Kinzoo presents a strong business and technical profile with a focus on child safety and privacy, but should improve transparency by publishing privacy and terms policies and clarifying domain registration details to enhance trust and compliance.

30
83
2
55
-
80
100
child-safekidsappsmessagingvideocallingcreativeapps+3 more
Google AnalyticsGoogle Tag ManagerFacebook PixelSingular SDK+3
2025-10-12T17:48:14.012Z
stell-engineering.com favicon

Stell

stell-engineering.com

68
TechnologyUnited StatessmallMEDIUM

Stell is a US-based technology company specializing in secure requirements management software tailored for mission-critical and highly regulated industries such as aerospace and defense. Their platform transforms complex technical documentation into actionable workflows, emphasizing collaboration, compliance, and security. The company highlights its adherence to stringent government security standards including SOC 2 Type 2 certification, NIST 800-171 compliance, and holds an IL5 ATO under U.S. Space Force sponsorship, underscoring its commitment to security and trustworthiness. Technically, Stell's website is built on the Squarespace platform, leveraging modern web technologies including JavaScript, Typekit fonts, and embedded video players. The site is well-optimized for mobile devices and demonstrates good SEO and accessibility practices, though some improvements are possible. The security posture is strong with HTTPS enforced and HSTS enabled, and no obvious vulnerabilities detected in the site content or scripts. However, the WHOIS data for the domain is missing or unavailable, which raises concerns about domain registration legitimacy. Additionally, the site lacks explicit privacy and cookie policies, as well as direct contact information, which are important for compliance and user trust. Marketing and analytics tools such as Google Tag Manager and LinkedIn Insight are used, indicating moderate user tracking. Overall, Stell presents as a professional and secure SaaS provider in a niche market, but should address privacy compliance gaps and verify domain registration details to enhance trust and regulatory adherence.

45
53
47
80
62
85
100
requirementsmanagementaerospacedefensesoftwaresecure+5 more
Squarespace CMSJavaScriptTypekit fontsGoogle Tag Manager+1
2025-10-12T17:47:48.888Z
nutrisense.io favicon

Nutrisense

nutrisense.io

72
HealthcareUnited StatesmediumMEDIUM

Nutrisense is a healthcare-focused company specializing in personalized metabolic health insights through continuous glucose monitoring (CGM) technology combined with expert dietitian coaching. The company targets individuals seeking sustainable health improvements such as weight loss, energy enhancement, and better metabolic control. Their business model is subscription-based, offering CGM sensor deliveries and 1:1 coaching, with some services covered by insurance. The website reflects a mature digital presence with a strong brand, extensive member testimonials, and trust signals like high Trustpilot ratings. Technically, the website leverages modern web technologies including React, Webflow CMS, and AWS Cloudfront for hosting and content delivery. It integrates multiple marketing and analytics tools such as Klaviyo, TikTok Pixel, Facebook Pixel, Microsoft Clarity, and Google Tag Manager, indicating a sophisticated approach to user engagement and data-driven marketing. The site is well-optimized for mobile and accessibility, with fast performance and good SEO practices. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR. While explicit security headers are not fully confirmed in the provided data, the use of reputable third-party services and absence of exposed sensitive data suggest a solid security posture. However, the lack of publicly available incident response or security policy documents is a gap. The WHOIS data is unavailable due to a malformed request, limiting domain trust verification, but the overall site professionalism and branding support legitimacy. Overall, Nutrisense presents a trustworthy and professional online presence with strong business credibility and technical maturity. Strategic recommendations include enhancing public security disclosures, verifying and publishing security headers, and improving WHOIS transparency to bolster domain trust.

60
68
17
85
75
85
100
healthcareglucosemonitoringnutritioncoachingpersonalizedhealth+3 more
React (implied by bundle naming and module usage)Cloudfront CDNKlaviyo (marketing and analytics)TikTok Pixel+8
2025-10-12T17:47:38.870Z
E

Eye Magazine

eyemagazine.com

59
MediaUnited KingdomsmallMEDIUM

Eye Magazine is a niche print publication focused on graphic design and visual culture, targeting professionals and enthusiasts in the creative industry. The website serves as a portal for magazine content, subscription sales, event information, and blog updates. The business model relies on print magazine sales, subscriptions, and advertising revenue. The brand is established with a history dating back to 1990, positioning itself as a respected media outlet within its sector. Technically, the website employs standard web technologies including JavaScript, Google Tag Manager for analytics, and third-party advertising scripts from AdvertServe. The site is accessible and moderately optimized for performance and mobile devices, though improvements in accessibility and SEO could be made. No CMS or hosting provider details are evident from the source. From a security perspective, the site uses HTTPS but lacks visible security headers and formal privacy or cookie policies, which are important for compliance and user trust. No contact emails or incident response information are provided, limiting transparency. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, although the website content and branding appear professional and consistent. Overall, the website presents a professional front for Eye Magazine but would benefit from enhanced privacy compliance, security hardening, and transparency regarding domain registration and contact information to improve trust and reduce risk.

55
35
2
70
65
80
100
graphicdesignmagazinevisualculturemediaprintmagazine+3 more
JavaScriptGoogle Tag ManagerAdvertServe advertising scriptsFacebook SDK+1

Partner Domains:

eyemagazine.escosubs.co.uk
partner
2025-10-12T17:45:53.323Z
A

Alibaba's Tongyi Lab

wanaivideo.org

62
TechnologyN/amediumMEDIUM

Wan AI is an advanced AI-powered creative platform developed by Alibaba's Tongyi Lab, specializing in generating high-quality videos and images from text and images. The platform offers a wide range of AI services including Text-to-Video, Image-to-Video, Video Editing, Text-to-Image, and Video-to-Audio, leveraging state-of-the-art AI models such as Wan 2.1. Wan AI positions itself as a leading solution in the AI video generation market, outperforming many open-source and commercial competitors. The website is professionally designed, mobile-optimized, and provides extensive information about its capabilities and features. Technically, it uses modern web technologies including Next.js, Cloudflare DNS and registrar services, and integrates analytics tools like Microsoft Clarity and Google Tag Manager. Security posture is good with HTTPS and domain transfer protection, though DNSSEC is not enabled and some security headers are missing. Privacy compliance is weak due to the absence of privacy and cookie policies. The WHOIS data shows inconsistencies, notably a future domain creation date, which raises some concerns about domain legitimacy. Overall, Wan AI demonstrates strong technical and business maturity but should improve transparency and privacy compliance to enhance trust.

20
68
17
70
75
70
100
aivideogeneratorimagegeneratoralibabatongyilab+5 more
React (Next.js)Cloudflare DNS and registrarJavaScriptGoogle Tag Manager+1
2025-10-12T16:42:59.441Z
chatway.app favicon

Chatway Live Chat

chatway.app

60
TechnologyN/asmallMEDIUM

Chatway Live Chat is a SaaS provider specializing in live chat and customer engagement tools for websites. The platform offers a comprehensive suite of features including live chat, visitor insights, eCommerce integrations, team collaboration, multilingual support, and mobile applications for iOS and Android. Positioned as a modern and user-friendly solution, Chatway targets businesses seeking to enhance customer communication and support efficiency. The website demonstrates a professional design with clear navigation and rich content, supported by client logos and positive user reviews, indicating a strong market presence. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery, Slick Carousel, and AOS for animations. It integrates third-party services like Google Tag Manager for analytics and Poptin for marketing pixels. The site is mobile-optimized and uses HTTPS with service workers for progressive web app capabilities. However, there is room for improvement in security headers and explicit privacy and cookie policies. From a security perspective, the site uses HTTPS and modern web standards but lacks visible security headers and formalized security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the content. Privacy compliance is weak due to missing privacy and cookie policies, which could pose regulatory risks. Overall, Chatway presents a trustworthy and professional online presence with a solid technical foundation. Strategic improvements in privacy compliance, security headers, and contact transparency would enhance its security posture and regulatory adherence, further strengthening user trust and business credibility.

15
65
2
60
75
80
100
livechatcustomersupportecommerceteamcollaborationmultilingual+3 more
WordPress 6.8.3jQuery 3.7.1Slick CarouselAOS (Animate On Scroll)+3
2025-10-12T16:42:54.430Z
dynogee.com favicon

Dynogee

dynogee.com

46
TechnologyN/asmallHIGH

Dynogee is a technology startup specializing in dynamic image generation from Figma designs, offering a SaaS platform with a straightforward API and Figma plugin integration. The company targets developers and designers who need personalized assets at scale, such as dynamic link previews and email assets. The business model is subscription-based with usage tiers and a free trial, positioning Dynogee as a niche player in the design and developer tools market. The website is professionally designed, mobile-optimized, and provides clear pricing and onboarding paths. Technically, Dynogee leverages modern web technologies including JavaScript frameworks, Cloudflare for hosting and DNS, Google Tag Manager and PostHog for analytics, and Crisp Chat for customer engagement. The site loads quickly and is well-structured for SEO and accessibility, though some accessibility features could be improved. The use of Cloudflare Stream for video content and LemonSqueezy for payments indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses Cloudflare DNS with clientTransferProhibited domain status, enhancing domain security. However, DNSSEC is not enabled, and explicit security headers are not visible in the HTML source. There is no published security policy, incident response contact, or vulnerability disclosure program, which are areas for improvement. Privacy compliance is basic; a privacy policy and terms of service are present, but no cookie consent mechanism is implemented, which may pose GDPR compliance risks. Overall, Dynogee presents a credible and professional online presence with a solid technical foundation and clear business focus. The main risks relate to privacy compliance and security transparency. Strategic recommendations include enabling DNSSEC, publishing security and incident response policies, implementing cookie consent, and providing clearer contact information to enhance trust and compliance.

15
58
2
70
75
70
-
dynamicimagesfigmapluginapilinkpreviewssaas+1 more
JavaScriptCloudflare (DNS and hosting)Google Tag ManagerCrisp Chat+3
2025-10-12T16:40:37.106Z
waze.com favicon

Waze

waze.com

72
TechnologyN/alargeMEDIUM

Waze is a globally recognized community-based GPS navigation application that provides real-time driving directions, live traffic updates, and road condition alerts. Owned by Google, Waze leverages a large user community to deliver accurate and timely routing information, helping drivers avoid traffic congestion, accidents, and other road hazards. The website serves as a portal to the live map and related services, targeting drivers and commuters worldwide seeking efficient navigation solutions. Technically, the website is built on a modern JavaScript stack with heavy integration of Google services such as Google Maps API, Google Tag Manager, Google Analytics, and reCAPTCHA Enterprise for security. The site is well optimized for both desktop and mobile platforms, featuring responsive design, fast loading times, and good SEO practices. The use of Google infrastructure suggests robust hosting and scalability. From a security perspective, the site employs HTTPS with strong SSL configuration and uses Google’s reCAPTCHA Enterprise to mitigate automated abuse. While explicit security headers are not visible in the HTML, it is likely they are enforced at the server level. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong, with comprehensive privacy and cookie policies and consent mechanisms in place. However, no public security policy or vulnerability disclosure program was found. Overall, Waze.com presents a professional, trustworthy, and secure online presence consistent with a large technology company. The lack of WHOIS data is likely due to privacy protection, which is justified given the brand’s profile. The site is safe for general audiences and does not contain any adult or questionable content. Strategic recommendations include publishing a public security policy, vulnerability disclosure program, and ensuring explicit security headers are documented for transparency.

80
50
2
90
85
85
100
navigationtrafficmapscommunitygps+2 more
JavaScriptGoogle Maps APIGoogle Tag ManagerGoogle Analytics+1
2025-10-12T16:39:48.289Z
eventbrite.nl favicon

Eventbrite

eventbrite.nl

70
TechnologyNetherlandsenterpriseMEDIUM

Eventbrite is a leading global event technology platform that enables users in the Netherlands and worldwide to discover, create, and manage live events with integrated ticket sales. The platform targets both event organizers and attendees, offering comprehensive tools for event marketing, ticketing, and mobile engagement. Eventbrite holds a strong market position as a trusted and widely used service in the event management industry. Technically, the website leverages modern web technologies including React, Google Analytics, Google Tag Manager, and Branch.io for deep linking and tracking. It employs a robust consent management system (Transcend) to comply with privacy regulations. The site is well-optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital infrastructure. From a security perspective, Eventbrite enforces HTTPS, implements multiple security headers, and uses secure forms with CSRF protection. The presence of comprehensive privacy and cookie policies, along with consent mechanisms, indicates a strong commitment to GDPR compliance. No critical vulnerabilities or suspicious activities were detected, and the WHOIS data aligns with the company's legitimate business operations. Overall, Eventbrite's website demonstrates high professionalism, security maturity, and privacy compliance, making it a trustworthy platform for event-related activities.

30
73
17
100
72
75
100
eventdiscoveryticketingeventmanagementtechnologyonlineplatform+3 more
ReactGoogle AnalyticsGoogle Tag ManagerBranch.io+3

Partner Domains:

eventbritestatus.com
partner
2025-10-12T16:38:23.017Z