Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

151131
Websites
130
Industries
113
Countries
52
Avg Score
Page 355 of 1033|Showing 17701-17750 of 51621
technologymagazine.com favicon

Technology Magazine

technologymagazine.com

74
TechnologyUnited KingdommediumMEDIUM

Technology Magazine is a well-established media platform founded in 2003, specializing in technology news, digital transformation, cloud computing, cybersecurity, AI, and related sectors. It offers a comprehensive suite of services including magazines, newsletters, webinars, reports, and industry events, targeting technology professionals and IT decision makers. The website demonstrates a strong market position as a leading technology media brand with consistent branding and high-quality content. Technically, the site leverages modern web technologies such as Next.js, Cloudflare DNS/CDN, and integrates multiple analytics and marketing tools including Google Analytics, Microsoft Clarity, and CookiePro for cookie consent management. The site is mobile-optimized, fast, and SEO-friendly, providing an excellent user experience. Security-wise, the site uses HTTPS with good SSL configuration and Cloudflare DNS but lacks DNSSEC and explicit security or incident response policies. Privacy compliance is partial, with a cookie consent mechanism present but no visible privacy policy or terms of service pages. Overall, the domain registration data is consistent and trustworthy, supporting the legitimacy of the business.

45
83
55
75
75
80
100
technologymediadigitaltransformationcloudcomputingcybersecurity+3 more
React (Next.js)Google AnalyticsGoogle Tag ManagerCloudflare DNS+5

Partner Domains:

aimagazine.com
partner
cybermagazine.com
partner
2025-10-12T17:50:46.762Z
inventive.ai favicon

Inventive.ai

inventive.ai

70
TechnologyN/asmallMEDIUM

Inventive.ai is a technology company specializing in AI-powered software for automating responses to RFPs, RFIs, security questionnaires, and DDQs. Their platform leverages advanced AI agents and integrates with popular enterprise tools to streamline proposal workflows, improve response accuracy, and increase win rates. The company positions itself as an innovative leader in the AI RFP automation market, backed by reputable investors and emphasizing security and compliance. Technically, the website is built on modern web technologies including Webflow CMS, HubSpot analytics, Microsoft Clarity, and Google Tag Manager. The site is well-optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital infrastructure. The use of multiple integrations and advanced AI capabilities indicates a sophisticated technical stack supporting their SaaS offering. From a security perspective, Inventive.ai demonstrates strong practices including HTTPS enforcement, SOC 2 compliance, end-to-end encryption, and role-based access controls. While explicit security headers are not fully documented in the HTML, the overall posture is robust with no visible vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with GDPR and CCPA adherence and a clear cookie consent mechanism. Overall, Inventive.ai presents a trustworthy and professional online presence with a strong focus on AI-driven business solutions. The lack of public WHOIS data due to privacy protection is typical for technology startups and does not detract from the legitimacy indicated by the website content and trust signals. Strategic recommendations include enhancing transparency around incident response and vulnerability disclosure to further strengthen security confidence.

60
80
17
65
65
85
100
airfpsaassecuritycompliance+3 more
Webflow CMSGoogle FontsHubSpot AnalyticsMicrosoft Clarity+2
2025-10-12T17:49:56.666Z
fireflies.ai favicon

Digital Privacy Corporation

fireflies.ai

73
TechnologyUnited StatesmediumMEDIUM

Fireflies.ai is a technology company specializing in AI-powered meeting transcription, summarization, and conversation intelligence. Founded in 2017 and operated by Digital Privacy Corporation in the United States, it offers a SaaS platform that integrates with popular meeting and productivity tools to enhance team collaboration and productivity. The company positions itself as an industry leader with a strong market presence, serving over 500,000 companies globally. Their key services include high-accuracy transcription, multi-language support, speaker recognition, AI summaries, and integrations with CRM, project management, and communication platforms. Technically, the website is built on modern frameworks such as Next.js and leverages Cloudflare for DNS and CDN services. It employs multiple analytics and marketing tools including Heap Analytics, Google Tag Manager, Facebook Pixel, and ProfitWell, indicating a mature digital marketing and data collection strategy. The site is well-optimized for performance, mobile responsiveness, and SEO, providing an excellent user experience. From a security perspective, the site uses HTTPS with a clientTransferProhibited domain status, indicating domain transfer protection. It holds GDPR and SOC2 certifications, signaling compliance with key data protection standards. However, DNSSEC is not enabled, and no explicit security.txt or vulnerability disclosure pages were found. No direct contact emails or phone numbers are publicly listed, which may impact user trust and support accessibility. Overall, Fireflies.ai presents a professional, secure, and compliant online presence with strong business credibility and technical maturity. Strategic recommendations include enabling DNSSEC, publishing a security policy or vulnerability disclosure, and providing clearer contact information to enhance trust and compliance further.

50
65
47
80
75
80
100
aimeetingtranscriptionproductivitysaastechnology+1 more
React (Next.js)Cloudflare DNSHeap AnalyticsGoogle Tag Manager+6
2025-10-12T17:49:36.562Z
adcreative.ai favicon

AdCreative.ai

adcreative.ai

68
TechnologyN/amediumMEDIUM

AdCreative.ai is a technology-driven SaaS platform specializing in AI-powered advertising solutions. It offers a comprehensive suite of tools including ad creative generation, product photoshoots, video creation, competitor insights, and compliance checking. The platform targets marketers, e-commerce businesses, and agencies aiming to optimize their advertising campaigns with data-driven and automated creative content. The website demonstrates a strong market position with claims of being the #1 most used AI tool for advertising and a user base exceeding 3 million worldwide. Technically, the website is built on Webflow CMS and integrates multiple modern analytics and marketing technologies such as Google Tag Manager, TikTok Pixel, Mixpanel, Amplitude, Hotjar, and PartnerStack. It supports multi-language capabilities via Weglot and uses video.js for media playback. The site is well-optimized for mobile devices, SEO, and accessibility, providing a professional user experience. From a security perspective, the site uses HTTPS and implements a cookie consent mechanism compliant with GDPR. However, explicit security headers and incident response policies are not evident in the provided data. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is unavailable or privacy protected, which is common for SaaS businesses and does not detract from the site's legitimacy given the strong trust signals present. Overall, AdCreative.ai presents a mature, professional, and trustworthy online presence with robust technical infrastructure and compliance practices. Strategic recommendations include enhancing security headers, publishing security policies, and providing clearer contact information to further improve trust and security posture.

45
80
17
85
52
80
100
aiadvertisingmarketingsaase-commerce+3 more
Webflow CMSVideo.jsGoogle Tag ManagerTikTok Pixel+6
2025-10-12T17:49:26.005Z
pillar.io favicon

Domains By Proxy, LLC

pillar.io

58
TechnologyUnited StatesmediumMEDIUM

Pillar.io is a SaaS platform focused on empowering social media creators, coaches, and digital marketers by providing an all-in-one link in bio tool that enables users to create, host, and sell digital products and services. The platform integrates marketing tools, AI assistants, and e-commerce capabilities to automate creator business operations and facilitate brand deals. With a user base exceeding 100,000 creators, Pillar positions itself as a comprehensive solution in the creator economy space. Technically, the website leverages modern web technologies including Webflow CMS, Google Tag Manager, TikTok and Facebook Pixels, PostHog analytics, and personalization tools like Intellimize. Hosting appears to be on AWS infrastructure with GoDaddy as the domain registrar. The site is mobile optimized and demonstrates good SEO and accessibility practices, though some accessibility features are basic. From a security perspective, the website enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, DNSSEC is not enabled, and no explicit security headers or policies are published. The site lacks visible privacy and cookie policies, which impacts privacy compliance scores. No vulnerabilities or exposed sensitive data were detected in the HTML content. Overall, Pillar.io presents a professional and functional platform with moderate security and privacy compliance maturity. Strategic improvements in privacy disclosures, security headers, and DNS security would enhance trust and compliance.

30
53
2
55
67
80
100
creatortoolslinkinbioe-commercemarketingsaas+3 more
Webflow CMSGoogle Tag ManagerTikTok PixelFacebook Pixel+3
2025-10-12T17:48:25.580Z
motork.io favicon

MotorK

motork.io

62
TransportationN/amediumMEDIUM

MotorK is a SaaS software provider specializing in automotive management solutions tailored for car dealers, distributors, and manufacturers. The company offers a comprehensive suite of products including dealership websites, CRM and lifecycle management, vehicle management, traffic acquisition, and e-reputation tools. Positioned as a digital transformation enabler in the automotive sector, MotorK targets industry professionals seeking to enhance customer journeys and operational efficiency. The website reflects a mature digital presence with strong SEO and structured data, indicating a well-established market position since at least 2019. Technically, the website is built on WordPress with Elementor and integrates modern marketing and analytics tools such as Google Tag Manager, Google Analytics, Mautic, and Iubenda for privacy compliance. The site is mobile-optimized and performs moderately well, with good accessibility and SEO practices. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, alongside a comprehensive cookie consent mechanism. However, explicit security headers and dedicated security policies are absent, suggesting room for improvement in security posture. The security evaluation shows a solid baseline with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with GDPR-aligned cookie consent and privacy policies. The absence of WHOIS data due to privacy protection is typical for commercial entities and does not detract from the site's legitimacy, which is supported by professional content and multiple trust signals. Overall, the site presents a low-risk profile with recommendations to enhance security headers and publish incident response information. Strategically, MotorK should focus on formalizing security policies, implementing vulnerability disclosure mechanisms, and enhancing accessibility to maintain trust and compliance as it scales. The digital infrastructure is sound but could benefit from continuous security audits and modernization to sustain competitive advantage and protect customer data.

45
73
35
75
-
85
100
saasautomotivecrmdigitalizationcardealers+4 more
WordPressElementorYoast SEOGoogle Tag Manager+3

Partner Domains:

investors.motork.io
subsidiary
2025-10-12T17:48:20.295Z
kinzoo.com favicon

Kinzoo

kinzoo.com

54
TechnologyN/asmallMEDIUM

Kinzoo is a technology company specializing in safe and creative applications for children, focusing on secure communication and interactive content that fosters connection and creativity without exposure to ads or strangers. The company offers three main products: Kinzoo Messenger, Kinzoo Together, and Kinzoo Studio, each designed to provide a child-friendly digital experience. The website is well-designed, mobile-optimized, and features multiple positive testimonials and certifications from recognized child safety organizations, positioning Kinzoo as a trusted niche player in child-safe technology apps. Technically, the website leverages modern web technologies including Webflow CMS, Google Analytics, Google Tag Manager, Facebook Pixel, and Singular SDK for analytics and marketing. It employs HTTPS with strong security headers, cookie consent mechanisms, and multimedia content to engage users effectively. The site demonstrates good performance and accessibility standards. From a security perspective, the site shows good practices such as HTTPS enforcement and security headers, but lacks explicit privacy and terms of service pages, which are important for compliance and user trust. The absence of WHOIS data for the domain raises concerns about domain registration transparency, although the website content and certifications suggest legitimacy. Overall, Kinzoo presents a strong business and technical profile with a focus on child safety and privacy, but should improve transparency by publishing privacy and terms policies and clarifying domain registration details to enhance trust and compliance.

30
83
2
55
-
80
100
child-safekidsappsmessagingvideocallingcreativeapps+3 more
Google AnalyticsGoogle Tag ManagerFacebook PixelSingular SDK+3
2025-10-12T17:48:14.012Z
stell-engineering.com favicon

Stell

stell-engineering.com

68
TechnologyUnited StatessmallMEDIUM

Stell is a US-based technology company specializing in secure requirements management software tailored for mission-critical and highly regulated industries such as aerospace and defense. Their platform transforms complex technical documentation into actionable workflows, emphasizing collaboration, compliance, and security. The company highlights its adherence to stringent government security standards including SOC 2 Type 2 certification, NIST 800-171 compliance, and holds an IL5 ATO under U.S. Space Force sponsorship, underscoring its commitment to security and trustworthiness. Technically, Stell's website is built on the Squarespace platform, leveraging modern web technologies including JavaScript, Typekit fonts, and embedded video players. The site is well-optimized for mobile devices and demonstrates good SEO and accessibility practices, though some improvements are possible. The security posture is strong with HTTPS enforced and HSTS enabled, and no obvious vulnerabilities detected in the site content or scripts. However, the WHOIS data for the domain is missing or unavailable, which raises concerns about domain registration legitimacy. Additionally, the site lacks explicit privacy and cookie policies, as well as direct contact information, which are important for compliance and user trust. Marketing and analytics tools such as Google Tag Manager and LinkedIn Insight are used, indicating moderate user tracking. Overall, Stell presents as a professional and secure SaaS provider in a niche market, but should address privacy compliance gaps and verify domain registration details to enhance trust and regulatory adherence.

45
53
47
80
62
85
100
requirementsmanagementaerospacedefensesoftwaresecure+5 more
Squarespace CMSJavaScriptTypekit fontsGoogle Tag Manager+1
2025-10-12T17:47:48.888Z
nutrisense.io favicon

Nutrisense

nutrisense.io

72
HealthcareUnited StatesmediumMEDIUM

Nutrisense is a healthcare-focused company specializing in personalized metabolic health insights through continuous glucose monitoring (CGM) technology combined with expert dietitian coaching. The company targets individuals seeking sustainable health improvements such as weight loss, energy enhancement, and better metabolic control. Their business model is subscription-based, offering CGM sensor deliveries and 1:1 coaching, with some services covered by insurance. The website reflects a mature digital presence with a strong brand, extensive member testimonials, and trust signals like high Trustpilot ratings. Technically, the website leverages modern web technologies including React, Webflow CMS, and AWS Cloudfront for hosting and content delivery. It integrates multiple marketing and analytics tools such as Klaviyo, TikTok Pixel, Facebook Pixel, Microsoft Clarity, and Google Tag Manager, indicating a sophisticated approach to user engagement and data-driven marketing. The site is well-optimized for mobile and accessibility, with fast performance and good SEO practices. From a security perspective, the site enforces HTTPS and employs cookie consent mechanisms compliant with GDPR. While explicit security headers are not fully confirmed in the provided data, the use of reputable third-party services and absence of exposed sensitive data suggest a solid security posture. However, the lack of publicly available incident response or security policy documents is a gap. The WHOIS data is unavailable due to a malformed request, limiting domain trust verification, but the overall site professionalism and branding support legitimacy. Overall, Nutrisense presents a trustworthy and professional online presence with strong business credibility and technical maturity. Strategic recommendations include enhancing public security disclosures, verifying and publishing security headers, and improving WHOIS transparency to bolster domain trust.

60
68
17
85
75
85
100
healthcareglucosemonitoringnutritioncoachingpersonalizedhealth+3 more
React (implied by bundle naming and module usage)Cloudfront CDNKlaviyo (marketing and analytics)TikTok Pixel+8
2025-10-12T17:47:38.870Z
E

Eye Magazine

eyemagazine.com

59
MediaUnited KingdomsmallMEDIUM

Eye Magazine is a niche print publication focused on graphic design and visual culture, targeting professionals and enthusiasts in the creative industry. The website serves as a portal for magazine content, subscription sales, event information, and blog updates. The business model relies on print magazine sales, subscriptions, and advertising revenue. The brand is established with a history dating back to 1990, positioning itself as a respected media outlet within its sector. Technically, the website employs standard web technologies including JavaScript, Google Tag Manager for analytics, and third-party advertising scripts from AdvertServe. The site is accessible and moderately optimized for performance and mobile devices, though improvements in accessibility and SEO could be made. No CMS or hosting provider details are evident from the source. From a security perspective, the site uses HTTPS but lacks visible security headers and formal privacy or cookie policies, which are important for compliance and user trust. No contact emails or incident response information are provided, limiting transparency. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, although the website content and branding appear professional and consistent. Overall, the website presents a professional front for Eye Magazine but would benefit from enhanced privacy compliance, security hardening, and transparency regarding domain registration and contact information to improve trust and reduce risk.

55
35
2
70
65
80
100
graphicdesignmagazinevisualculturemediaprintmagazine+3 more
JavaScriptGoogle Tag ManagerAdvertServe advertising scriptsFacebook SDK+1

Partner Domains:

eyemagazine.escosubs.co.uk
partner
2025-10-12T17:45:53.323Z
A

Alibaba's Tongyi Lab

wanaivideo.org

62
TechnologyN/amediumMEDIUM

Wan AI is an advanced AI-powered creative platform developed by Alibaba's Tongyi Lab, specializing in generating high-quality videos and images from text and images. The platform offers a wide range of AI services including Text-to-Video, Image-to-Video, Video Editing, Text-to-Image, and Video-to-Audio, leveraging state-of-the-art AI models such as Wan 2.1. Wan AI positions itself as a leading solution in the AI video generation market, outperforming many open-source and commercial competitors. The website is professionally designed, mobile-optimized, and provides extensive information about its capabilities and features. Technically, it uses modern web technologies including Next.js, Cloudflare DNS and registrar services, and integrates analytics tools like Microsoft Clarity and Google Tag Manager. Security posture is good with HTTPS and domain transfer protection, though DNSSEC is not enabled and some security headers are missing. Privacy compliance is weak due to the absence of privacy and cookie policies. The WHOIS data shows inconsistencies, notably a future domain creation date, which raises some concerns about domain legitimacy. Overall, Wan AI demonstrates strong technical and business maturity but should improve transparency and privacy compliance to enhance trust.

20
68
17
70
75
70
100
aivideogeneratorimagegeneratoralibabatongyilab+5 more
React (Next.js)Cloudflare DNS and registrarJavaScriptGoogle Tag Manager+1
2025-10-12T16:42:59.441Z
chatway.app favicon

Chatway Live Chat

chatway.app

60
TechnologyN/asmallMEDIUM

Chatway Live Chat is a SaaS provider specializing in live chat and customer engagement tools for websites. The platform offers a comprehensive suite of features including live chat, visitor insights, eCommerce integrations, team collaboration, multilingual support, and mobile applications for iOS and Android. Positioned as a modern and user-friendly solution, Chatway targets businesses seeking to enhance customer communication and support efficiency. The website demonstrates a professional design with clear navigation and rich content, supported by client logos and positive user reviews, indicating a strong market presence. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery, Slick Carousel, and AOS for animations. It integrates third-party services like Google Tag Manager for analytics and Poptin for marketing pixels. The site is mobile-optimized and uses HTTPS with service workers for progressive web app capabilities. However, there is room for improvement in security headers and explicit privacy and cookie policies. From a security perspective, the site uses HTTPS and modern web standards but lacks visible security headers and formalized security or incident response policies. No vulnerabilities or exposed sensitive data were detected in the content. Privacy compliance is weak due to missing privacy and cookie policies, which could pose regulatory risks. Overall, Chatway presents a trustworthy and professional online presence with a solid technical foundation. Strategic improvements in privacy compliance, security headers, and contact transparency would enhance its security posture and regulatory adherence, further strengthening user trust and business credibility.

15
65
2
60
75
80
100
livechatcustomersupportecommerceteamcollaborationmultilingual+3 more
WordPress 6.8.3jQuery 3.7.1Slick CarouselAOS (Animate On Scroll)+3
2025-10-12T16:42:54.430Z
dynogee.com favicon

Dynogee

dynogee.com

46
TechnologyN/asmallHIGH

Dynogee is a technology startup specializing in dynamic image generation from Figma designs, offering a SaaS platform with a straightforward API and Figma plugin integration. The company targets developers and designers who need personalized assets at scale, such as dynamic link previews and email assets. The business model is subscription-based with usage tiers and a free trial, positioning Dynogee as a niche player in the design and developer tools market. The website is professionally designed, mobile-optimized, and provides clear pricing and onboarding paths. Technically, Dynogee leverages modern web technologies including JavaScript frameworks, Cloudflare for hosting and DNS, Google Tag Manager and PostHog for analytics, and Crisp Chat for customer engagement. The site loads quickly and is well-structured for SEO and accessibility, though some accessibility features could be improved. The use of Cloudflare Stream for video content and LemonSqueezy for payments indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses Cloudflare DNS with clientTransferProhibited domain status, enhancing domain security. However, DNSSEC is not enabled, and explicit security headers are not visible in the HTML source. There is no published security policy, incident response contact, or vulnerability disclosure program, which are areas for improvement. Privacy compliance is basic; a privacy policy and terms of service are present, but no cookie consent mechanism is implemented, which may pose GDPR compliance risks. Overall, Dynogee presents a credible and professional online presence with a solid technical foundation and clear business focus. The main risks relate to privacy compliance and security transparency. Strategic recommendations include enabling DNSSEC, publishing security and incident response policies, implementing cookie consent, and providing clearer contact information to enhance trust and compliance.

15
58
2
70
75
70
-
dynamicimagesfigmapluginapilinkpreviewssaas+1 more
JavaScriptCloudflare (DNS and hosting)Google Tag ManagerCrisp Chat+3
2025-10-12T16:40:37.106Z