Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 33 of 1003|Showing 1601-1650 of 50115
P

PeoplesBank

bankatpeoples.com

67
FinanceUnited StatesmediumMEDIUM

PeoplesBank is a regional mutual community bank serving personal and business customers primarily in Western Massachusetts and Northern Connecticut. The bank offers a comprehensive range of financial services including personal and business checking and savings accounts, mortgage and home equity loans, business lending, cash management, and wealth management services. The website reflects a well-established financial institution with a strong local presence and community focus. The bank positions itself as a trusted local banking partner with a mutual ownership structure, emphasizing customer service and community involvement. Technically, the website employs a modern technology stack including jQuery, Bootstrap, and multiple analytics and advertising tracking tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is mobile optimized, accessible, and SEO friendly with proper metadata and structured navigation. Performance is moderate with good user experience and professional design quality. From a security perspective, the site enforces HTTPS, uses frame busting to prevent clickjacking, and provides cookie consent mechanisms. However, it lacks some advanced security headers and publicly available security or incident response policies. The WHOIS data for the domain is unavailable, which is unusual for a bank and slightly reduces trust, but the presence of regulatory trust seals and consistent branding supports legitimacy. Overall, PeoplesBank's website demonstrates a mature digital presence with good security hygiene and comprehensive service offerings. Strategic improvements in transparency around security policies and WHOIS data disclosure would enhance trust and compliance posture.

85
100
70
72
75
53
2
bankpersonalbankingbusinessbankingmortgagehomeloans+3 more
jQueryBootstrapGoogle Tag ManagerFacebook Pixel+9

Partner Domains:

bankatpeoples.mymortgage-online.com
partner
onboard.bankatpeoples.com
service

+1 more partners

2026-07-04T07:22:15.008Z
tsg.je favicon

Total Solutions Group (TSG) Jersey

tsg.je

61
TechnologyJerseymediumMEDIUM

Total Solutions Group (TSG) Jersey is a leading information management and technology services provider based in Jersey, serving clients across the Channel Islands, UK, Gibraltar, Mauritius, and South Africa. The company offers a broad range of services including document management, scanner hardware support, robotic process automation, GDPR consultancy, and information security. Their market position is strong regionally, supported by partnerships with recognized technology providers such as Kofax and Mitratech. The website reflects a professional business model focused on B2B services with clear contact channels and trust indicators such as Cyber Essentials certification. Technically, the website is built on WordPress using modern plugins like WPBakery Page Builder and LayerSlider. It employs HTTPS with good SSL configuration and includes responsive design elements for mobile optimization. However, some technical improvements are recommended, including the implementation of security headers and proper configuration of analytics tools. The website's performance is moderate with basic SEO and accessibility features. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and no visible sensitive data exposure. The presence of Cyber Essentials certification indicates a commitment to security standards. However, the absence of security headers and lack of an incident response or vulnerability disclosure policy are areas for improvement. Privacy compliance is partially met with privacy and cookie policies present, but the lack of a cookie consent mechanism reduces compliance confidence. Overall, the website is trustworthy, professional, and well-positioned in its market niche. Strategic recommendations include enhancing security headers, implementing cookie consent, configuring analytics properly, and publishing explicit security and incident response policies to strengthen compliance and trust.

62
70
72
20
80
55
47
informationmanagementtechnologyservicesconsultancydocumentmanagementroboticprocessautomation+2 more
WordPressPHPjQueryLayerSlider+4

Partner Domains:

kofax.com
partner
mitratech.com
partner
2026-07-04T07:20:06.691Z
express-exports.co.uk favicon

Express Export Services

express-exports.co.uk

52
TransportationUnited KingdomsmallMEDIUM

Express Export Services Limited is a UK-based international shipping and logistics company with over 50 years of experience. The company offers a broad range of services including parcel delivery, pallet and crate shipping, container shipping, vehicle shipping, international removals, antiques and artwork shipping, oversized cargo handling, professional packing, and customs/documentation assistance. Their target audience includes individuals, families, and businesses requiring reliable and secure international shipping solutions. The website presents a professional and consistent brand image with clear navigation and comprehensive service descriptions. Technically, the website employs modern frontend technologies such as Bootstrap, jQuery, and Owl Carousel, ensuring good mobile responsiveness and user experience. The site uses Google reCAPTCHA to protect forms from spam. However, there is no evidence of advanced security headers or cookie consent mechanisms, which are important for GDPR compliance and security hardening. From a security perspective, the website is accessible without WAF or blocking mechanisms, but lacks several security best practices such as security headers and explicit incident response contacts. The WHOIS data for the domain is unavailable due to a domain registration error indicating the domain name contains too many parts and cannot be registered, which raises concerns about domain legitimacy and ownership consistency. Overall, the website is professional and functional with good content quality and business credibility. However, the domain registration anomaly and missing security headers reduce the overall trust score. Strategic improvements in domain registration verification, security header implementation, and privacy compliance are recommended to enhance trust and security posture.

27
70
60
100
2
35
53
internationalshippingfreightforwardinglogisticsparceldeliveryvehicleshipping+2 more
BootstrapjQueryjQuery bxSliderOwl Carousel+4
2026-07-04T07:19:50.891Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
rjevansroofing.com favicon

RJ Evans Flat Roofing Limited

rjevansroofing.com

52
Real EstateUnited KingdommediumMEDIUM

RJ Evans Flat Roofing Limited is a UK-based commercial roofing contractor specializing in engineered roofing systems for commercial and industrial buildings nationwide. The company offers a comprehensive range of services including installation, repair, inspection, and maintenance of flat and low-slope roofing systems tailored to meet UK regulatory and environmental demands. Their market position is strong, supported by multiple industry accreditations and positive customer testimonials, targeting commercial property owners and facilities managers across the UK. Technically, the website employs modern web technologies such as Google Analytics, Bootstrap, and hCaptcha, indicating a moderate to advanced digital maturity. The site is well-structured, mobile-optimized, and SEO-friendly, though some improvements in accessibility and security headers could enhance its technical posture. From a security perspective, the site benefits from HTTPS and form protection via hCaptcha, alongside cookie consent mechanisms supporting GDPR compliance. However, the absence of visible security headers and lack of explicit incident response or security policy pages suggest areas for improvement. The missing WHOIS data introduces some uncertainty regarding domain registration legitimacy, though the website content and trust signals mitigate this concern. Overall, RJ Evans presents a professional and trustworthy online presence with solid business credibility and technical implementation. Strategic enhancements in security practices and domain registration transparency would further strengthen their security posture and trustworthiness.

57
60
-
85
68
40
25
commercialroofingflatroofingroofingcontractorwaterproofingukroofing+2 more
Google AnalyticsGoogle Tag ManagerhCaptchajQuery+3
2026-07-04T07:17:54.656Z
agencyspace.co.uk favicon

Agencyspace

agencyspace.co.uk

43
MediaUnited KingdomsmallHIGH

Agencyspace is a well-established independent global creative company specializing in advertising, content creation, and experiential marketing. The company positions itself as a forward-thinking agency that helps brands go beyond conventional marketing approaches to become distinctive and memorable. The website reflects a professional and consistent brand image with clear messaging targeted at ambitious brands seeking innovative marketing solutions. The company operates primarily in the media sector and is based in the United Kingdom, with a domain age indicating a mature business presence since 2003. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and integrates Google Analytics and Tag Manager for tracking. The site demonstrates good mobile optimization, SEO practices, and moderate performance. However, some accessibility features could be improved. Security-wise, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the security posture is adequate but could be enhanced by implementing security headers, cookie consent, and incident response information. The business credibility is high due to clear contact information, professional design, and consistent branding. There are no indications of malicious or adult content, making the site safe for general audiences. The domain registration data supports the legitimacy of the business with consistent and transparent WHOIS information. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, publishing security and incident response policies, and maintaining regular updates to WordPress and plugins to mitigate vulnerabilities.

70
47
75
-
15
2
53
creativeagencyadvertisingbrandingmediamarketing+1 more
WordPress 7.0Yoast SEO pluginjQueryGoogle Analytics+4
2026-07-04T07:17:49.347Z
edmonds-accountancy.co.uk favicon

Edmonds Accountancy Ltd.

edmonds-accountancy.co.uk

48
FinanceUnited KingdomsmallHIGH

Edmonds Accountancy Ltd. is a professional accountancy firm based in Reading, Berkshire, UK, offering a wide range of accounting and business advisory services tailored to both businesses and individuals. The company emphasizes client support, transparency with no hidden fees, and expertise in areas such as VAT returns, payroll, self-assessments, and cloud accounting. Their market position is that of a local, approachable, and trusted accounting partner with a strong focus on client relationships and business growth support. Technically, the website is built on WordPress and leverages modern web technologies including jQuery, Gravity Forms for data collection, Google Analytics, Google Tag Manager, Microsoft Clarity, Facebook Pixel for tracking, and Google reCAPTCHA v3 for form security. The site is mobile-optimized, accessible, and SEO-friendly, with a professional design and clear navigation. From a security perspective, the website enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security headers such as Content-Security-Policy and X-Frame-Options, which could enhance protection. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. The main concern is the failure to retrieve WHOIS data due to domain naming rules issues, which limits verification of domain legitimacy. Strategic recommendations include improving security headers, verifying domain registration status, and publishing a security policy to enhance trust and compliance.

57
20
70
60
15
17
68
accountancyaccountantsbusinessadvicefinancereading+5 more
jQueryGravity FormsGoogle AnalyticsGoogle Tag Manager+3
2026-07-04T07:16:51.457Z
noticeboardtv.com favicon

NoticeBoardTv Ltd

noticeboardtv.com

44
HealthcareUnited KingdomsmallHIGH

NoticeBoardTv Ltd is a UK-based company specializing in providing professional waiting room information screen solutions primarily for healthcare providers such as GP surgeries, dentists, hospitals, clinics, pharmacies, and veterinary practices. Established since 2006, the company offers a SaaS model combining hardware control boxes with pre-loaded software and a user-friendly control panel for live content updates, including YouTube integration and content libraries. Their market position is niche and focused on improving patient experience by reducing perceived wait times through engaging digital signage. Technically, the website employs modern web technologies including HTML5, CSS3, Bootstrap, jQuery, and popular JavaScript libraries for sliders and carousels. It integrates Google Analytics and CANDDi for visitor tracking and marketing insights. The site is mobile responsive with good SEO and basic accessibility features, though some improvements could be made in security headers and cookie consent mechanisms. From a security perspective, the site uses HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks explicit security policies, incident response contacts, and cookie consent banners, which are important for GDPR compliance. The WHOIS data is missing or indicates the domain may not be properly registered, which raises concerns about domain legitimacy despite the professional appearance of the site. Overall, the website presents a professional and trustworthy front for a small healthcare technology business, but the absence of WHOIS data and some privacy compliance features suggest areas for improvement. Strategic recommendations include enhancing security headers, implementing cookie consent, clarifying domain registration, and adding security and incident response policies to strengthen trust and compliance.

70
85
-
47
53
2
15
healthcareinformationscreenswaitingroomukgpsurgeries+2 more
HTML5CSS3JavaScriptjQuery+6

Partner Domains:

www.nbtv.co.uk
partner
2026-07-04T07:16:35.696Z
compositesevolution.com favicon

Composites Evolution

compositesevolution.com

45
ManufacturingUnited KingdomsmallHIGH

Composites Evolution is a UK-based small manufacturing business specializing in the production and supply of prepreg composite materials. Established in 2009, the company positions itself as a niche supplier within the composites industry, targeting business customers and professionals requiring advanced composite solutions. The website prominently features partnerships such as with Simcas Composites, indicating a collaborative business model focused on product availability and distribution. Technically, the website is built on WordPress using modern frameworks and plugins including Divi Builder and Yoast SEO, supported by common libraries like jQuery and Bootstrap. The site demonstrates good mobile optimization and SEO practices but lacks some advanced accessibility features. Security posture is moderate with HTTPS enabled and domain transfer protections in place, but lacks DNSSEC and explicit security headers. Privacy compliance is weak due to absence of privacy and cookie policies or consent mechanisms. Overall, the domain registration data is consistent with the business claims, enhancing credibility. Strategic improvements in privacy compliance and security hardening are recommended to elevate trust and compliance.

37
75
70
40
15
17
35
compositesprepregmanufacturingb2bindustrial
jQueryBootstrap 4.6Yoast SEO pluginDivi Builder plugin+4

Partner Domains:

simcascomposites.com
partner
2026-07-04T07:15:16.719Z
E

Euro Drive Systems Ltd

eurodrivesystems.com

44
ManufacturingUnited KingdomsmallHIGH

Euro Drive Systems Ltd is a UK-based supplier specializing in industrial electric motors, compact gear motors, frequency inverters, and power transmission components. The company operates from two UK depots, offering competitive pricing, warranty, and technical support, with a focus on next-day delivery for most products. They hold exclusive distribution agreements with several manufacturers, positioning themselves as a trusted supplier in the manufacturing sector. Technically, the website uses standard web technologies including jQuery and Font Awesome, with a basic but functional design. The site is accessible over HTTPS, though it lacks advanced security headers and privacy policies. Mobile optimization and accessibility are basic, and no analytics or tracking scripts were detected, indicating a minimal data collection approach. From a security perspective, the site has a moderate posture with HTTPS enabled but missing key security headers and privacy compliance documentation. The absence of WHOIS registration data raises concerns about domain legitimacy, which impacts overall trust. No forms or email addresses are present, reducing attack surface but also limiting user engagement channels. Overall, the website is professional and business-focused but would benefit from improved security practices, privacy compliance, and domain registration transparency to enhance trust and reduce risk.

60
47
85
20
50
2
20
industrialmotorsgearmotorsfrequencyinverterspowertransmissionmanufacturing+1 more
jQueryFont AwesomeCSS3HTML5
2026-07-04T07:14:55.575Z
jaderecruitment.net favicon

Jade Recruitment

jaderecruitment.net

46
OtherUnited KingdomsmallHIGH

Jade Recruitment Ltd is a well-established recruitment agency operating primarily in Surrey and Hampshire, UK, since 1987. The company specializes in matching candidates with temporary and permanent job opportunities across commercial, catering, care, and industrial sectors. They also provide HR consultancy services to employers lacking in-house HR teams. The website reflects a professional business with clear service offerings, a focus on local recruitment, and a strong emphasis on personalized candidate-employer matching. Their market position is that of a trusted local agency with longstanding client relationships. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, WP Job Manager, and Slider Revolution. It employs Google Analytics for visitor tracking and is optimized for mobile devices with good SEO practices. Performance is moderate, with room for improvement in accessibility and security headers. The site uses HTTPS with a valid SSL certificate, ensuring secure communications. From a security perspective, the site demonstrates basic good practices such as HTTPS enforcement and no visible sensitive data exposure. However, it lacks advanced security headers and a published incident response or vulnerability disclosure policy. Privacy compliance is partially addressed with privacy and cookie policies present, though no explicit cookie consent mechanism is implemented. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, which should be further investigated. Overall, Jade Recruitment presents a credible and professional online presence with a solid business foundation. Strategic improvements in security posture, privacy compliance, and domain registration transparency would enhance trust and reduce risk exposure.

57
75
55
-
15
2
85
recruitmentjobshrconsultancysurreyhampshire+2 more
WordPressPHPjQueryGoogle Analytics+3
2026-07-04T07:14:08.261Z
blumin.co.uk favicon

Blumin

blumin.co.uk

61
TechnologyUnited KingdommediumMEDIUM

Blumin is an award-winning full service design agency operating primarily in Cornwall, Manchester, and Cheshire, UK. They specialize in branding, website design and development, bespoke web software, and marketing strategies aimed at launching, growing, and transforming businesses. Their market position is strong regionally with a focus on integrating brand and digital services to deliver comprehensive solutions. The website is professionally designed with excellent content quality and clear navigation, targeting business clients seeking digital and branding services. Technically, the website leverages modern web technologies including Webflow CMS, Google Tag Manager, Microsoft Clarity, LinkedIn Insight Tag, and Sentry for error monitoring. The site is hosted on Webflow's CDN, ensuring fast performance and mobile optimization. Privacy compliance is well addressed with a cookie consent mechanism and a comprehensive privacy policy. However, explicit security headers are not detected in the HTML, which could be improved. Security posture is good with HTTPS enforced and no exposed sensitive data, but the absence of security headers and incident response information suggests room for enhancement. The WHOIS lookup failed due to a domain registration error indicating the domain name contravenes Nominet UK naming rules, which is unusual and reduces trust slightly. Despite this, the website content and business information appear legitimate and professional. Overall, the website presents a low risk with strong business credibility and technical maturity. Strategic recommendations include implementing security headers, publishing incident response and security policies, and resolving domain registration inconsistencies to enhance trust and compliance.

65
44
100
85
83
30
2
brandingwebdesignsoftwaredevelopmentmarketingstrategiesdigitaltransformation+3 more
WebflowjQueryGoogle Tag ManagerMicrosoft Clarity+4
2026-07-04T07:13:10.410Z
odesa.co.uk favicon

Odesa Limited

odesa.co.uk

54
OtherUnited KingdomsmallMEDIUM

Odesa Limited is a well-established professional cleaning company based in Southwest London, with over 20 years of experience. The company specializes in cleaning services across multiple sectors including offices, schools, retail, and communal areas. Their market position is that of a trusted local expert with a strong client retention rate, supported by recognized certifications such as ISO 14001 and OHSAS 18001. The website reflects a professional business model focused on service delivery to local institutions and businesses. Technically, the website is built on WordPress and employs modern web technologies including Google reCAPTCHA for form security and ShortPixel for image optimization. Hosting is provided by Krystal Hosting Ltd, a reputable UK-based provider. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with room for improvement in loading speed and accessibility. From a security perspective, the site enforces HTTPS and includes a Content-Security-Policy header, which are positive indicators. However, additional security headers are missing, and there is no visible formal security or incident response policy. The absence of a cookie consent mechanism suggests partial GDPR compliance. No vulnerabilities or exposed sensitive data were detected, indicating a generally sound security posture. Overall, the website is professional, trustworthy, and well-aligned with the company's business claims. Strategic improvements in privacy compliance and security policy transparency would enhance the site's risk profile and user trust.

62
60
85
20
55
17
53
cleaningprofessionalserviceslondonofficecleaningretailcleaning+1 more
WordPressPHPjQueryGoogle reCAPTCHA+2
2026-07-04T07:12:59.884Z
ukpworldwide.com favicon

UKP Worldwide

ukpworldwide.com

46
OtherUnited KingdomsmallHIGH

UKP Worldwide is a specialist service provider focusing on customs clearance for eCommerce parcels and mail to and from the UK, including returns management and duty reclaim services. The company targets businesses involved in eCommerce logistics, offering niche expertise in customs and returns processes. The website presents a professional and consistent brand image with clear business descriptions and social media presence, indicating a small but focused operation founded around 2019. Technically, the website is built on WordPress using the Divi theme and common plugins such as Yoast SEO and Contact Form 7. It employs tracking and analytics tools like Microsoft Clarity and Google Tag Manager, indicating a moderate level of digital maturity. The site is mobile optimized and SEO friendly but lacks advanced accessibility features. From a security perspective, the website lacks visible security headers and explicit privacy or cookie policies, which reduces its compliance posture. The WHOIS data is incomplete or unavailable, raising concerns about domain registration transparency. No critical vulnerabilities or exposed sensitive data were detected, but improvements in security best practices and compliance documentation are recommended. Overall, the website is functional and professional but would benefit from enhanced security configurations, transparent privacy policies, and verified domain registration information to improve trust and compliance.

70
20
70
57
68
15
2
customsclearanceecommercereturnsmanagementdutyreclaimlogistics+1 more
Google Tag ManagerMicrosoft ClarityYoast SEOContact Form 7+2
2026-07-04T07:10:26.611Z
mandmdirect.com favicon

MandM

mandmdirect.com

72
RetailUnited KingdomlargeMEDIUM

MandM is a well-established UK-based e-commerce retailer specializing in branded clothing, footwear, and accessories at discounted prices. The website targets men, women, and children primarily in the UK and European markets. It offers a broad range of products from big brands, positioning itself as a cost-effective alternative to traditional retail. The business model focuses on direct online sales with a strong digital presence and customer engagement through multiple social media platforms. Technically, the website employs modern web technologies including Vue.js, jQuery, and Algolia for search functionality, supported by robust tracking and marketing tools such as Google Tag Manager and Exponea. Hosting and content delivery appear to be managed via Akamai CDN, ensuring good performance and availability. The site is mobile-optimized and incorporates accessibility features, though there is room for improvement in accessibility compliance. From a security perspective, the site enforces HTTPS with strong SSL configurations and implements security headers like Content Security Policy and X-Frame-Options. Cookie consent and privacy policies are comprehensive and GDPR compliant, reflecting a mature privacy posture. However, explicit security policies and incident response information are not publicly available, which could be enhanced to improve transparency and trust. Overall, MandM demonstrates a strong digital maturity and business credibility with a secure and user-friendly platform. The absence of WHOIS data is likely due to privacy protection and does not detract from the legitimacy of the business. Strategic recommendations include publishing detailed security policies, adding vulnerability disclosure mechanisms, and enhancing accessibility to further strengthen the website's security and compliance posture.

82
100
85
85
2
70
73
e-commerceretailclothingfootwearfashion+6 more
JavaScriptVue.jsjQueryAlgolia Search+3

Partner Domains:

osm.klarnaservices.com
partner
2026-07-04T07:09:02.566Z
H

Hallmark Luxury Care Homes

hallmarkcarehomes.co.uk

58
HealthcareUnited KingdommediumMEDIUM

Hallmark Luxury Care Homes is a family-run provider of luxury care homes across England and Wales, specializing in residential, dementia, respite, and nursing care. The company positions itself as an award-winning, top 20 care home group with a strong reputation for relationship-centred care and high resident satisfaction. Their website reflects a mature digital presence with rich content, professional design, and clear navigation tailored to seniors and their families seeking premium care services. Technically, the website leverages a modern technology stack including PHP with Laravel, WordPress CMS, Microsoft Azure hosting, and integrates advanced analytics and marketing tools such as Google Analytics, Microsoft Clarity, LiveChat, and CookieYes for consent management. The site is mobile-optimized and demonstrates good SEO and accessibility practices. From a security perspective, the site enforces HTTPS, uses anti-forgery tokens, DDoS protection, and bot detection mechanisms. Cookie consent is actively managed with user customization options. However, explicit security headers could be more clearly implemented and documented. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. The lack of WHOIS data for the queried subdomain is a minor anomaly but does not detract from the legitimacy of the business. Strategic recommendations include enhancing security header implementation, publishing a vulnerability disclosure policy, and improving public availability of privacy and security policies.

100
85
42
70
15
17
50
luxurycarehomeshealthcareseniorlivingdementiacareresidentialcare+3 more
PHPLaravel FrameworkMicrosoft AzureGoogle Tag Manager+6

Partner Domains:

carehome.co.uk
partner
careers.hallmarkcarehomes.co.uk
subsidiary
2026-07-04T07:08:20.413Z