Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 294 of 556|Showing 14651-14700 of 27753
sildamies.lv favicon

Sildamies.lv

sildamies.lv

42
EnergyLatviasmallHIGH

Sildamies.lv is a Latvian small business specializing in the sales and installation of heat pumps and ventilation systems, featuring brands such as Panasonic, Daikin, Alpha Innotec, and Nibe. The website targets local customers interested in energy-efficient HVAC solutions. The business appears to have been founded in 2018 and maintains a consistent brand presence with a Facebook page and professional website design. Technically, the website is built on WordPress with Yoast SEO plugin and uses Google Analytics and Google Tag Manager for user tracking. The site shows moderate performance and good mobile optimization but lacks explicit privacy and cookie policies, which impacts its privacy compliance score. No forms or direct contact information were found in the provided HTML snippet, limiting insights into data collection practices. From a security perspective, HTTPS is implied but security headers are not detected, and no WHOIS data was available due to query limits, preventing domain registration verification. The site does not exhibit any obvious vulnerabilities or exposed sensitive data but would benefit from improved security headers and privacy compliance measures. Overall, the website presents a moderate risk profile with good business credibility but gaps in privacy compliance and security best practices. Strategic recommendations include implementing privacy and cookie policies with consent mechanisms, adding security headers, and ensuring WHOIS data transparency to enhance trustworthiness.

15
10
17
70
62
75
20
heatpumpshvacenergylatviapanasonic+3 more
WordPressYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+1
2025-07-30T16:00:27.303Z
D

Droni.lv

droni.lv

45
RetailLatviasmallHIGH

Droni.lv is a Latvian-based retailer specializing in the sale, rental, and repair of drones, including industrial, FPV, agricultural, and consumer models. The company operates an e-commerce platform built on WordPress and WooCommerce, offering a wide range of drone products and accessories. Their market position is that of a specialized local provider catering to both individual consumers and businesses interested in drone technology. The website is professionally designed with clear navigation and multilingual support, targeting Latvian, English, and Russian speakers. Contact information and a physical store address in Riga enhance their credibility. Technically, the website leverages modern web technologies including jQuery, Google Tag Manager, Facebook Pixel, and chat support via OnWebChat. The platform is optimized for mobile devices and includes SEO best practices. Security posture is adequate with HTTPS enabled and cookie consent mechanisms in place, though some security headers are missing and no explicit vulnerability disclosure or security policy is found. Privacy compliance is supported by a comprehensive privacy policy and cookie banner, indicating GDPR awareness. Overall, the website presents a trustworthy and professional front for a small retail business in the drone sector. The lack of WHOIS data limits full domain trust verification, but the visible business information and technical setup suggest legitimacy. Security improvements are recommended to enhance header protections and incident response readiness. The site is safe for general audiences with no adult or questionable content detected.

15
33
17
55
62
80
20
dronesretaile-commercelatviatechnology+2 more
WordPressWooCommercejQueryGoogle Tag Manager+4
2025-07-30T16:00:27.153Z
immunitas.life favicon

SIA «DONUMSILVA»

immunitas.life

48
E-commerceLatviasmallHIGH

Immunitas.life is a small Latvian e-commerce business specializing in the sale of water ionizers designed to purify and mineralize drinking water. The company, legally registered as SIA «DONUMSILVA», operates a professionally designed WordPress website with WooCommerce for online sales. The site targets health-conscious consumers interested in improving water quality through ionization technology. The business presents clear contact information and company registration details, enhancing its credibility in the market. Technically, the website leverages modern WordPress plugins such as Elementor and Kadence theme, ensuring a good user experience and mobile optimization. Hosting appears to be provided by MySecureCloudHost, as indicated by the nameservers. While the site uses HTTPS and domain registration protections, it lacks advanced security headers and DNSSEC, which are recommended for enhanced security. No cookie consent or explicit GDPR compliance mechanisms are present, which could pose compliance risks. From a security perspective, the website shows a moderate posture with no visible vulnerabilities or exposed sensitive data. However, the absence of published security policies and incident response contacts limits transparency. The domain WHOIS data is consistent with the business information, supporting legitimacy. Overall, the site is functional and trustworthy but would benefit from improved security and privacy compliance measures. Strategic recommendations include enabling DNSSEC, implementing security headers, adding cookie consent and GDPR compliance features, and publishing clear security and incident response policies to strengthen trust and regulatory adherence.

15
35
2
85
77
75
20
healthwaterionizere-commercerussianlatvia+2 more
WordPressWooCommerceElementorKadence Theme+2
2025-07-30T16:00:26.809Z
augustastallis.lv favicon

Zirgu asistētas mācīšanās un terapijas centrs

augustastallis.lv

51
OtherLatviasmallMEDIUM

Zirgu asistētas mācīšanās un terapijas centrs operates the website zirguterapijascentrs.lv, providing equine-assisted learning and therapy services primarily in Latvia. The business targets individuals, families, couples, and corporate groups interested in therapeutic and educational experiences involving horses. The website demonstrates a niche market position with a small business scale, offering services such as therapy sessions, excursions, and corporate events. The content is well-structured, professionally presented, and supported by active social media channels, enhancing credibility and user engagement. Technically, the website is built on WordPress with WooCommerce for e-commerce capabilities, utilizing modern plugins like Yoast SEO and Cookiebot for SEO and privacy compliance. The site employs Google Tag Manager and Google reCAPTCHA for analytics and security. Performance is moderate with good mobile optimization and basic accessibility features. Structured data (JSON-LD) is implemented for enhanced SEO. From a security perspective, the site enforces HTTPS with good SSL configuration and includes standard security headers. Forms are protected with reCAPTCHA, and no sensitive data is exposed in the HTML. However, there is no publicly available security policy or incident response information, which could be improved to enhance trust and compliance. Overall, the website presents a trustworthy and professional front for a small equine therapy business. The lack of WHOIS data limits domain legitimacy assessment, but the site’s content and technical setup indicate a legitimate operation. Strategic recommendations include publishing security policies, improving accessibility, and adding incident response contacts to strengthen security posture and compliance.

20
48
17
85
62
75
20
equinetherapyhorseassistedlearningtherapycenterlatviawoocommerce+1 more
WordPressWooCommerceYoast SEOGoogle Tag Manager+5
2025-07-30T16:00:26.510Z
A

AUTOHAOSS

autohaoss.lv

38
TransportationLatviasmallHIGH

AUTOHAOSS is a small Latvian autosalon business specializing in used car sales, used car spare parts, car rental, car exchange, 24-hour auto-evacuator technical assistance, and vehicle servicing. The website is built on WordPress and uses common JavaScript libraries such as jQuery and Owl Carousel for image carousels. The site content is primarily in Latvian and targets general consumers interested in automotive services. The business appears to be local with no indication of a larger corporate structure or subsidiaries. Technically, the website employs HTTPS ensuring secure connections, but lacks advanced security headers and privacy-related policies such as cookie or privacy policies. No contact emails or phone numbers are explicitly provided on the homepage, which limits direct communication channels. The site shows basic mobile optimization and SEO practices but could benefit from improvements in accessibility and performance. From a security perspective, the site has a moderate posture with HTTPS enabled but missing security headers and no visible vulnerability disclosures or incident response information. The absence of WHOIS data due to query limits restricts domain legitimacy verification, but the website content and structure do not raise immediate red flags. Overall, the site is functional but lacks comprehensive privacy and security compliance features. Strategically, the business should focus on enhancing trust by adding clear contact information, privacy and cookie policies, and implementing security best practices such as security headers. Regular updates and monitoring of the WordPress CMS and plugins are recommended to mitigate vulnerabilities. These steps will improve user trust, compliance with regulations, and overall security posture.

15
10
2
60
62
75
20
autosalonusedcarscarrentalcarservicewordpress+1 more
WordPressjQueryOwl Carousel
2025-07-30T16:00:26.504Z
nordconnect.com favicon

Nord Connect

nordconnect.com

58
TelecommunicationsEstoniasmallMEDIUM

Nord Connect is a telecommunications service provider based in Estonia, offering a full range of communications services that blend classic telephony traditions with modern telephony technologies. The website is currently in a 'coming soon' state but provides essential contact information and a form for customer inquiries. The company appears to be a small-sized entity with a domain age dating back to 2013, indicating an established presence in the market. Technically, the website is built on WordPress using Elementor and WPForms, with a moderate performance profile and basic mobile optimization. The site lacks advanced SEO and accessibility features but maintains a clean and functional design. Security posture is moderate with HTTPS enabled but missing important security headers and DNSSEC, which are recommended for enhanced protection. From a security and compliance perspective, the site lacks privacy and cookie policies, which are critical for GDPR compliance and user trust. No incident response or vulnerability disclosure information is provided. The contact information is transparent and consistent with the WHOIS data, supporting business credibility. Overall, the site is safe with no adult or questionable content detected. Strategic recommendations include implementing comprehensive privacy and cookie policies, enabling DNSSEC, adding security headers, and improving SEO and accessibility to enhance user experience and compliance.

-
35
2
70
100
85
100
WordPressElementorjQueryTailwind CSS+1
2025-07-30T16:00:26.213Z
S

SIA Petrow

petroff.lv

47
OtherLatviasmallHIGH

SIA Petrow is a Latvian legal services firm specializing in insolvency, civil and criminal law, crisis asset management, and legal support for investment projects. The firm positions itself as a leader in these legal domains within Latvia, targeting both individual and corporate clients. Their website presents a professional image with multilingual content in Latvian, Russian, and English, highlighting their key services and successful case outcomes. Contact information including a physical address, phone number, and email is clearly provided, enhancing business credibility. Technically, the website is built on WordPress using common plugins such as WPBakery Page Builder and Contact Form 7. It employs modern web technologies including HTTPS, jQuery, and Font Awesome icons. The site is mobile-optimized and demonstrates good SEO practices, though accessibility features are basic. Performance is moderate, with no critical technical issues detected. From a security perspective, the site enforces HTTPS but lacks visible security headers and does not provide a privacy or cookie policy, which are important for GDPR compliance. No incident response or vulnerability disclosure information is present. Tracking scripts from Facebook and ShareThis are used, indicating moderate user tracking. The absence of WHOIS data due to query limits limits domain trust analysis, but the website content and contact details suggest legitimacy. Overall, the website is professional and functional with room for improvement in privacy compliance and security best practices. Strategic recommendations include adding privacy and cookie policies, implementing security headers, and publishing incident response contacts to enhance trust and compliance.

15
25
17
70
72
75
20
legallawfirminsolvencycivillawcriminallaw+2 more
WordPressjQueryWPBakery Page BuilderContact Form 7+4
2025-07-30T16:00:26.180Z
mvtranspoint.com favicon

MV Transpoint

mvtranspoint.com

51
TransportationLatviasmallMEDIUM

MV Transpoint is a Latvia-based logistics company specializing in warehousing, cargo storage, and road transport services across Baltic and EU countries. With over 15 years of experience, the company positions itself as a reliable and loyal partner offering comprehensive logistics solutions including product issue and consultations. The website reflects a professional business with clear service offerings and client testimonials, targeting businesses requiring efficient logistics support. Technically, the website is built on WordPress using Elementor, integrated with Google Analytics and Facebook Pixel for marketing and tracking. The site is mobile-optimized and demonstrates good SEO practices, though performance is moderate. Security posture is adequate with HTTPS enabled and secure forms, but lacks advanced security headers and explicit security policies. Overall, the security posture is solid but could be improved by enabling DNSSEC, adding security headers, and publishing incident response information. Privacy compliance is basic with privacy and cookie policies present and consent mechanisms implemented. The domain WHOIS data is consistent with the business claims, enhancing trustworthiness. Strategically, MV Transpoint should focus on enhancing security transparency and compliance documentation to strengthen trust and meet evolving regulatory requirements. The website serves as a credible digital front for the company’s logistics services with room for technical and security enhancements.

72
60
85
20
73
2
20
logisticswarehousingtransportcargostorageroadtransport+3 more
WordPressElementorGoogle AnalyticsFacebook Pixel+1
2025-07-30T16:00:26.150Z
jahtas.eu favicon

SIA BOFORS

jahtas.eu

50
TransportationLatviasmallMEDIUM

Jahtas.lv, operated by SIA BOFORS, is a well-established Latvian company specializing in the sale and servicing of new and used watercraft since 2006. The company offers a comprehensive range of services including boat sales, winter storage, summer mooring, equipment sales, engine maintenance, hull repairs, and other boat management services. Positioned as a local leader in the water transport sector, Jahtas.lv targets boat owners and maritime enthusiasts primarily in Latvia. The website reflects a professional business with clear contact information and a detailed FAQ section, supporting customer engagement and trust. Technically, the website is built on WordPress using popular plugins such as Elementor and Revolution Slider, with SEO optimization via Rank Math and analytics through Google Analytics. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and security header implementation. Hosting is managed through GoDaddy, a reputable registrar and hosting provider. From a security perspective, the site uses HTTPS and includes reCAPTCHA for form protection, but lacks explicit security headers and published security policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is limited due to the absence of privacy and cookie policies, which is a notable compliance gap. Overall, the security posture is moderate but could be enhanced with additional measures. The overall risk assessment indicates a legitimate and trustworthy business with minor compliance and security improvements recommended. Strategic focus should be on enhancing privacy compliance, implementing security headers, and publishing incident response and vulnerability disclosure information to strengthen trust and regulatory adherence.

100
75
40
75
2
15
10
boatsyachtswatercraftmarineservicesboatsales+2 more
WordPressElementorRevolution SliderjQuery+5
2025-07-30T16:00:25.974Z
S

SIA IM LATVIJA

topo.lv

9
Real EstateLatviasmallCRITICAL

SIA IM LATVIJA operates as a specialized surveying and geodesy service provider in Latvia, established in 2011. The company offers a range of services including topography, execution measurements, geodesy, aerial measurements, and 3D model creation, leveraging advanced Trimble technology to ensure high precision. Their market position is that of a small, service-oriented business focused on personalized client engagement and rapid order fulfillment across Latvia. The website reflects a professional and consistent brand image with clear contact information and business credentials. Technically, the website is built on WordPress using the Divi theme, incorporating modern web technologies such as jQuery, Google Fonts, and image optimization via Optimole. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with no critical technical issues detected. However, security headers are absent, and privacy-related policies are missing, indicating areas for improvement. From a security perspective, the site benefits from HTTPS encryption but lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms. No vulnerabilities or exposed sensitive data were detected in the analysis. The absence of privacy and cookie policies reduces compliance with GDPR and related regulations. Overall, the security posture is moderate but could be enhanced by implementing recommended best practices. The overall risk assessment suggests a legitimate, small business website with good content quality and technical implementation but with gaps in privacy compliance and security transparency. Strategic recommendations include adding privacy and cookie policies, implementing security headers, establishing incident response contacts, and publishing vulnerability disclosure information to strengthen trust and compliance.

-
-
-
-
-
-
-
surveyinggeodesytopography3dmodelinglatvia+1 more
WordPressDivi ThemejQueryGoogle Fonts+2
2025-07-30T16:00:25.931Z