Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 144 of 153|Showing 7151-7200 of 7637
N

no-one.nl is for sale !!

no-one.nl

34
OtherN/asmallHIGH

The website no-one.nl is a minimalistic domain-for-sale landing page offering the premium domain name for purchase. It targets domain investors or buyers interested in acquiring this specific domain. The site provides a simple form to request an offer, protected by Google reCAPTCHA v2 to prevent spam submissions. However, the site lacks any privacy, cookie, or terms of service policies, and does not provide any contact emails, phone numbers, or physical addresses, which limits trust and transparency. Technically, the site uses common front-end technologies such as Bootstrap, Font Awesome, Animate.css, Google Fonts, and jQuery. The form uses Google reCAPTCHA v2 for bot protection. The site appears to be served over HTTP without HTTPS, which is a significant security concern. No security headers or advanced security frameworks are detected. The site is basic in design and mobile optimization, with moderate performance. From a security perspective, the absence of HTTPS and security headers reduces the security posture significantly. The use of reCAPTCHA is a positive measure against spam. No vulnerabilities or exposed sensitive data were detected in the HTML content. The lack of privacy and cookie policies indicates poor privacy compliance. WHOIS data shows privacy protection for the registrant, which is typical for domain sales but reduces transparency. Overall, the website scores low on trustworthiness and professionalism due to minimal content, lack of business information, and poor security practices. Strategic recommendations include implementing HTTPS, adding privacy and cookie policies, providing clear contact information, and improving security headers and compliance measures.

15
-
-
60
-
60
100
domainsalepremiumdomaindomainmarketplacedomainoffer
BootstrapFont AwesomeAnimate.cssGoogle Fonts (Raleway)+2
2025-06-21T18:21:54.738Z
kidstart.co.uk favicon

KidStart Limited

kidstart.co.uk

54
FinanceUnited KingdommediumMEDIUM

KidStart Limited operates a UK-based cashback platform designed to help families save money for their children by earning cashback on everyday online purchases from a wide range of partner retailers. The website is well-branded and targets parents, grandparents, and family members interested in building savings for children. The business model leverages affiliate partnerships with major retailers and financial services, including a Junior ISA offering. The site demonstrates a solid market position with visible trust indicators such as FCA authorization and customer testimonials. Technically, the website uses a traditional tech stack including jQuery, Font Awesome, Facebook SDK, and Google Analytics. While the site is mobile-optimized and has good SEO practices, some technical debt is evident with the use of an older jQuery version and lack of modern security headers. Performance is moderate, and accessibility is basic but functional. From a security perspective, the site enforces HTTPS and integrates secure Facebook OAuth login flows. However, it lacks explicit security headers and uses an outdated JavaScript library version, which could expose it to vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR indicators. No direct contact emails or phone numbers are provided on the main pages, which may affect user trust slightly. Overall, KidStart presents a trustworthy and professional online presence with a good balance of business credibility and privacy compliance. Security posture is adequate but could be improved by updating libraries and adding security headers. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements in security and contact transparency would enhance trust and resilience.

55
43
-
85
-
70
100
cashbackchildrensavingsfamilyfinanceshoppinguk+2 more
jQuery 1.10.1Font AwesomeFacebook SDKGoogle Analytics+2

Partner Domains:

beanstalkapp.co.uk
partner
smart.link
partner
2025-06-21T18:21:54.663Z
portmesse.com favicon

Nagoya International Exhibition Hall

portmesse.com

44
HospitalityJapanlargeHIGH

Nagoya International Exhibition Hall (ポートメッセなごや) operates as a major international exhibition and event venue located in Nagoya, Japan. The facility caters to a broad range of events including seminars, business meetings, exhibitions, ceremonies, parties, incentives, concerts, and other communication spaces. It serves event organizers and visitors primarily in the hospitality and government sectors, positioning itself as a key regional player in event hosting and venue services. Technically, the website is built on WordPress 4.9.9 with a variety of plugins such as Contact Form 7 for forms, Smart Slider 3 for visual content, and FooBox for image lightbox functionality. The site uses jQuery and jQuery UI libraries and integrates Google Tag Manager for analytics and marketing. The site is mobile optimized and includes accessibility features, but the WordPress version is outdated, which may pose security risks. From a security perspective, the site enforces HTTPS and uses Google Tag Manager and reCAPTCHA on forms, but lacks comprehensive security headers and runs an outdated CMS version. No explicit security or incident response policies are published. Privacy compliance is basic with a privacy policy present but no cookie consent mechanism detected. Overall, the website is professional and trustworthy with good business credibility and content quality. However, security and privacy compliance could be improved by updating software, adding security headers, and implementing cookie consent mechanisms.

15
53
25
55
52
80
-
exhibitioneventsconferencenagoyajapan+3 more
jQueryjQuery UISmart Slider 3Font Awesome+4

Partner Domains:

party-maker.jp
partner
strings-group.jp
partner

+3 more partners

2025-06-20T12:05:21.903Z
vialatvia.com favicon

Secretariat of Latvian Ports, Transit and Logistics Council

vialatvia.com

62
TransportationLatviasmallMEDIUM

VIA Latvia operates as a unifying information portal for the Latvian transport and logistics industry, providing comprehensive sector information, contact details, and industry news. The website targets professionals and stakeholders in the transport sector, positioning itself as a key resource for Latvian transport modes including ports, railways, road transport, aviation, and logistics. The platform also supports multilingual access and participates in international expos, enhancing its industry presence. Technically, the website is built on WordPress using Elementor and several plugins such as Jet Elements and Cherry Framework. It employs modern JavaScript libraries like jQuery, Swiper, and Slider Pro for interactive elements. The site shows moderate performance and good mobile optimization, though accessibility features could be improved. SEO is basic but present with meta tags and structured navigation. Security posture is moderate with HTTPS usage and a cookie consent mechanism in place. However, no advanced security headers or explicit security policies are detected. No vulnerabilities or exposed sensitive data were found in the HTML content. Privacy compliance is basic, with a privacy and cookie policy present but no explicit GDPR compliance statements or data protection officer contact. Overall, the website is professional and trustworthy with a solid business credibility score. Recommendations include enhancing security headers, adding terms of service and incident response policies, improving accessibility, and strengthening privacy compliance to align with GDPR and other regulations.

20
68
25
85
50
70
100
transportlogisticslatviaportsrailway+4 more
jQuerySlider ProSwiperFont Awesome+6
2025-06-18T16:50:04.456Z
movebybike.se favicon

MoveByBike AB

movebybike.se

43
TransportationSwedenmediumHIGH

MoveByBike AB is a Nordic logistics company specializing in city-smart last mile deliveries using electric cargo bikes, operating primarily in Malmö, Stockholm, and Copenhagen. The company positions itself as a leader in sustainable urban logistics, offering efficient, fast, and environmentally friendly delivery solutions that bypass traditional vehicle restrictions in city centers. Their services include optimized routing, real-time delivery tracking, and flexible scheduling to meet customer demands. The website reflects a medium-sized enterprise with consistent branding and a professional online presence. Technically, the website is built on WordPress using the Elementor page builder and JupiterX theme, incorporating modern JavaScript libraries and Google Tag Manager for analytics. The site is mobile-optimized and performs moderately well, with good SEO and accessibility basics. Security-wise, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and explicit security policies or incident response information. Privacy compliance is partially addressed with a privacy policy but lacks cookie consent mechanisms. Overall, the website demonstrates a solid business credibility and technical maturity suitable for its market segment. However, improvements in security headers, privacy compliance (cookie consent), and explicit security incident response policies would enhance trust and compliance. The domain registration data aligns well with the business claims, supporting legitimacy and transparency.

25
-
5
70
-
60
100
logisticssustainabilityelectriccargobikelastmiledeliveryurbantransport+1 more
WordPressElementorJupiterX themejQuery+4

Partner Domains:

jobs.movebybike.com
partner
2025-06-18T08:56:12.557Z
S

Sapheneia

sapheneia.com

29
HealthcareUnited StatessmallHIGH

Sapheneia is a specialized healthcare technology company focused on medical imaging software innovations, particularly in radiation dose reduction and compliance with FDA and NEMA standards. Their partnership with Scannerside enhances their offerings with dose tracking and analytics solutions. The company targets healthcare providers and medical device manufacturers, providing vendor-neutral software solutions to optimize imaging and ensure regulatory compliance. The website reflects a professional business with clear service offerings and industry certifications, although some content such as privacy policies is missing. Technically, the website is built on an older WordPress platform with common plugins and libraries like jQuery and Bootstrap. While the site is functional and moderately optimized for mobile, it lacks HTTPS encryption and modern security headers, which are critical for protecting sensitive healthcare-related information. The use of outdated software versions poses potential security risks. From a security perspective, the absence of HTTPS and security headers, along with outdated libraries, lowers the security posture significantly. No explicit security or incident response policies are found on the site. Privacy compliance is weak, with no visible privacy or cookie policies despite the use of Google Analytics tracking. Contact information is available, including a phone number and physical address in Colorado, USA, supporting business credibility. Overall, the website is moderately professional and credible but requires urgent improvements in security and privacy compliance to meet modern standards and protect user data effectively.

15
10
-
70
-
75
-
medicalsoftwarehealthcaredosereductionxr-29complianceimagingoptimization
WordPress 4.6.29jQuery 1.12.4BootstrapFont Awesome+4

Partner Domains:

scannerside.com
partner
2025-06-18T08:56:08.045Z
alphaglobe.se favicon

AlphaGlobe Logistics AB

alphaglobe.se

35
TransportationSwedensmallHIGH

AlphaGlobe Logistics AB is a Swedish privately owned transportation and logistics company specializing in door-to-door freight solutions including air, sea, road, and rail freight, as well as courier, warehousing, and customs services. The company targets businesses and individuals requiring comprehensive logistics services, positioning itself as an experienced and reliable provider in the transportation sector. The website reflects a professional and consistent brand image with clear service offerings and contact channels. Technically, the website is built on WordPress using Elementor, leveraging modern web technologies such as jQuery and Font Awesome. The site is mobile-optimized and performs moderately well, with good SEO and accessibility basics. Google Analytics is used for user tracking, with a cookie consent mechanism in place to comply with GDPR. From a security perspective, the site enforces HTTPS and implements cookie consent but lacks explicit security headers and incident response information. No critical vulnerabilities or blocking mechanisms were detected, indicating a generally secure posture but with room for improvement in security best practices. Overall, the website presents a trustworthy and professional front for AlphaGlobe Logistics AB, with solid business credibility and compliance awareness. Strategic enhancements in security headers and incident response transparency would further strengthen its security posture and user trust.

15
15
5
85
-
60
20
logisticstransportationfreightairfreightseafreight+5 more
WordPressElementorjQueryFont Awesome+1
2025-06-18T08:56:04.969Z
xperitus.com favicon

xperitus

xperitus.com

49
TechnologySwedenmediumHIGH

xperitus is a well-established Oracle Partner specializing in ERP systems, particularly Oracle JD Edwards and NetSuite, with over 15 years of experience serving clients primarily in the Nordic region. The company offers comprehensive consulting services including ERP implementation, project management, and support, targeting businesses across manufacturing, distribution, life sciences, and oil & gas sectors. Their market position is strong as a leading Oracle JD Edwards provider in the Nordic market, supported by a professional and content-rich website that clearly communicates their expertise and service offerings. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies such as jQuery, Slick Carousel, and Google Tag Manager. The site demonstrates good performance, mobile optimization, and accessibility standards. Security is robust with HTTPS enforced, secure iframe embeds, and a cookie consent mechanism, although explicit security policies and incident response contacts are not published. The security posture is solid with no visible vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with comprehensive privacy and cookie policies, including consent mechanisms aligned with GDPR requirements. Business credibility is high, supported by clear contact information, customer testimonials, and trust indicators such as Oracle Partner certification. Overall, xperitus presents a trustworthy and professional digital presence with minor recommendations to enhance security transparency and incident response readiness.

45
40
-
55
-
65
100
erporaclepartnerjdedwardsnetsuitebusinesssystems+5 more
HubSpot CMSjQuerySlick CarouselMagnific Popup+7

Partner Domains:

oracle.com
partner
giantfocal.com
partner
2025-06-18T08:56:04.460Z
corelink.se favicon

Core Link AB

corelink.se

44
ManufacturingSwedenmediumHIGH

Core Link AB is a well-established Swedish company specializing in custom-made material handling systems primarily for the paper and converting industries. With over 50 years of experience and ISO 9001 certification, the company holds a strong market position offering a broad range of products including core handling, broke handling, roll handling, bale handling, and cooling rolls. Their business model focuses on B2B manufacturing and system integration with a clear emphasis on quality and customer service. The website reflects a professional and consistent brand image with good content relevance and navigation clarity. Technically, the website employs a modern technology stack including Bootstrap 4, Material Kit Pro, and various JavaScript libraries for enhanced user experience. The site is mobile optimized and SEO friendly, though accessibility features are basic. The CMS appears to be Umbraco, supporting structured content management. Performance is moderate with no major technical issues detected. From a security perspective, the site uses HTTPS (inferred from canonical link), has a cookie consent mechanism, and avoids exposing sensitive data. However, it lacks visible security headers and explicit security or incident response policies. No vulnerability disclosures or privacy policies are present, indicating room for improvement in compliance and transparency. Overall, the website is trustworthy and professional with a solid business foundation. Strategic enhancements in security policies, privacy compliance, and accessibility would further strengthen their digital maturity and risk posture.

15
-
-
85
-
70
100
manufacturingmaterialhandlingpaperindustryautomationiso9001+2 more
Bootstrap 4Google Fonts (Roboto, Roboto Slab, Material Icons)Font AwesomeMaterial Kit Pro v3.0.0+7

Partner Domains:

pesmel.fi
partner
trancel.se
subsidiary

+1 more partners

2025-06-18T08:56:02.926Z
adstringo.in favicon

ADSTRINGO SOFTWARE PRIVATE LIMITED

adstringo.in

33
TechnologyIndiasmallHIGH

AdStringO Software Private Limited is a technology company based in India specializing in endpoint digital compression solutions for images, audio, video, PDF, and Office files. Their technology enables enterprises to compress files up to 90% without loss of visual quality, facilitating digital transformation especially in low network environments such as rural areas. The company targets a broad audience including SMEs, government institutions, and Fortune 500 companies, positioning itself as a global leader in fast endpoint compression technology. The website employs a modern technology stack including jQuery, Bootstrap, and various UI libraries to deliver a responsive and user-friendly experience. However, the technical infrastructure lacks visible HTTPS enforcement and security headers, which are critical for secure communications and trust. The site is moderately optimized for mobile and SEO but lacks advanced accessibility features. From a security perspective, the absence of HTTPS and security policies, as well as no visible vulnerability disclosure or incident response information, indicates a low maturity level in security posture. The website does not provide privacy or cookie policies, which impacts compliance with GDPR and other privacy regulations. Contact information is clearly provided, including company emails, phone number, and physical address, supporting business credibility. Overall, while the business and website demonstrate good content quality and professional presentation, significant improvements in security, privacy compliance, and technical hardening are recommended to enhance trust and protect users. Strategic focus on implementing HTTPS, publishing privacy and security policies, and adopting security best practices will strengthen the company's digital presence and risk management.

15
10
13
65
-
80
20
compressionimagecompressionaudiocompressionvideocompressionpdfcompression+3 more
jQueryBootstrapFont AwesomeOwl Carousel+3
2025-06-18T08:56:00.918Z
axel.se favicon

Axel Group AB

axel.se

49
TechnologySwedenmediumHIGH

Axel Group AB is a leading Swedish company specializing in personal alarms, personal safety, and alarm services, with a strong focus on workplace safety, lone workers, and protection against violence and threats. The company offers a range of products including personal alarms, alarm services, vehicle tracking, and safety training, supported by a webshop for streamlined ordering. Their market position is strong within Sweden, targeting organizations and individuals requiring reliable safety solutions. Technically, the website is built on a modern stack using HTML5, CSS3, JavaScript, and integrates Google reCAPTCHA for form security. The site uses purePUBLISH CMS and is hosted by WebOne AB. The website demonstrates good mobile optimization, clear navigation, and professional design, although accessibility features are basic. Performance is moderate, with no major technical issues detected. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms from spam. However, explicit security headers like Content-Security-Policy and HSTS are not clearly present, and there is no visible vulnerability disclosure or security policy page. Privacy compliance is partial; a privacy policy and terms of service are present, but no cookie consent mechanism is detected, which may be a GDPR compliance gap. Overall, the website is professional, trustworthy, and well-maintained, with a solid business credibility score. Strategic improvements in privacy compliance and security headers would enhance their security posture and regulatory adherence.

65
-
-
70
-
75
100
personlarmpersonskerhetlarmtjnsterarbetsmiljskerhet+1 more
HTML5CSS3JavaScriptGoogle reCAPTCHA+4

Partner Domains:

butik.personlarm.se
partner
purepublish.se
partner

+1 more partners

2025-06-18T08:56:00.568Z
evoxtherapeutics.com favicon

Evox Therapeutics

evoxtherapeutics.com

51
HealthcareUnited KingdommediumMEDIUM

Evox Therapeutics is a UK-based biotechnology company specializing in transformative exosome therapeutics targeting severe neurological and neurodegenerative diseases. Leveraging proprietary ExoEdit™ technology and CRISPR/Cas gene editing encapsulated in exosome nanoparticles, Evox aims to develop innovative treatments addressing critical unmet medical needs. The company maintains a professional and content-rich website that clearly communicates its mission, pipeline, technology, and partnership opportunities, targeting patients, healthcare professionals, investors, and collaborators. Technically, the website is built on WordPress using the GeneratePress theme and Elementor page builder, incorporating modern web technologies such as jQuery and Font Awesome. SEO is enhanced via Yoast SEO plugin, and Google Tag Manager is used for analytics and marketing. The site is mobile-optimized with good navigation and accessibility features, although some accessibility and security header improvements are recommended. From a security perspective, the site enforces HTTPS and shows no signs of exposed sensitive data or vulnerable libraries. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not detected, and no formal security or incident response policies are published. Privacy compliance is partially addressed with a comprehensive privacy policy and terms of service, but lacks a cookie consent mechanism. Overall, Evox Therapeutics presents a credible and trustworthy online presence consistent with its business claims and domain registration data. Strategic recommendations include enhancing security headers, implementing cookie consent, publishing security policies, and improving accessibility to strengthen compliance and trust.

30
28
-
85
-
85
100
biotechnologyhealthcareexosometherapeuticsgeneeditingneurologicaldiseases+2 more
WordPressElementorYoast SEOjQuery+2
2025-06-18T08:56:00.563Z