Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 128 of 3147|Showing 6351-6400 of 157326
nortonpeskett.co.uk favicon

Norton Peskett Solicitors

nortonpeskett.co.uk

48
OtherUnited KingdommediumHIGH

Norton Peskett Solicitors is a well-established law firm based in East Anglia, UK, with a history dating back to the 1830s. The firm offers a comprehensive range of legal services to both individuals and businesses, including criminal defence, family law, employment law, residential and commercial property, injury claims, mediation, and wills and probate. With multiple branch offices and over 120 experienced employees, Norton Peskett holds a strong regional market position supported by numerous accreditations and client testimonials. The website reflects a professional and trustworthy business with clear contact information and a user-friendly design. Technically, the website is built on WordPress 7.0 with modern SEO and analytics tools such as Yoast SEO, Google Analytics, Google Tag Manager, and Hotjar. It employs HTTPS with good SSL configuration and uses Google reCAPTCHA to secure forms. Cookie consent mechanisms and a privacy policy indicate GDPR compliance. However, some security headers are not explicitly detected, and no dedicated security policy or incident response contact is published. From a security perspective, the site demonstrates good practices including HTTPS enforcement, anti-phishing warnings, and form protection. The absence of WHOIS data is unusual but likely due to querying the subdomain 'www' rather than the root domain. Despite this, the business legitimacy is supported by consistent branding, accreditations, and detailed contact information. Overall, the site scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. Recommendations include implementing comprehensive security headers, publishing a security policy and incident response contacts, and adding a security.txt file to facilitate vulnerability disclosures. These steps would enhance the security posture and trustworthiness further.

65
20
60
47
53
15
17
lawfirmsolicitorslegalserviceseastangliafamilylaw+5 more
WordPress 7.0Yoast SEO pluginGoogle AnalyticsGoogle Tag Manager+3

Partner Domains:

www.eastmediation.co.uk
partner
unity.online
partner
2026-07-02T07:19:51.531Z
connect2t.co.uk favicon

Connect 2 Technology

connect2t.co.uk

67
ManufacturingUnited KingdommediumMEDIUM

Connect 2 Technology is a well-established UK-based contract electronics manufacturer specializing in cable assemblies, wiring harnesses, electronic box build, and related interconnection solutions. With over 30 years of experience and part of the Cleveland Technologies Group, the company serves OEMs and engineering teams requiring reliable, custom manufacturing support from prototype to volume production. Their market position is strengthened by certifications such as ISO 9001:2015 and IPC A-620, and a clear focus on quality and UK manufacturing standards. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Tag Manager and Mux video streaming. The site demonstrates good performance, mobile optimization, and accessibility, with comprehensive SEO and metadata implementation. Privacy compliance is well addressed with a cookie consent banner and Google Consent Mode integration. From a security perspective, the site enforces HTTPS and employs standard best practices, though explicit security headers could be enhanced. No vulnerabilities or exposed sensitive data were detected. The WHOIS data confirms a long-standing domain registration consistent with the business history, enhancing trustworthiness. Overall, the website presents a professional, trustworthy, and compliant digital presence for a medium-sized manufacturing business. Strategic recommendations include improving security header implementation, publishing a formal security policy and incident response contacts, and considering a vulnerability disclosure policy to further enhance security posture and customer trust.

80
70
100
39
95
45
17
manufacturingcableassemblieselectronicsukcontractmanufacturing+2 more
HubSpot CMSGoogle Tag ManagerSlick CarouselMux Video Streaming+1

Partner Domains:

ctecgroup.co.uk
parent
pcb.co.uk
sister
2026-07-02T07:19:46.147Z
A

AVS Fencing & Landscaping Supplies Ltd

avsfencing.co.uk

70
RetailUnited KingdommediumMEDIUM

AVS Fencing & Landscaping Supplies Ltd is a well-established UK-based supplier specializing in fencing, landscaping, and outdoor living materials. With over 25 years of experience, the company serves both DIY enthusiasts and trade customers primarily in the South East of England. The website reflects a professional retail and trade supplier business model with a clear focus on quality products and customer service. The company maintains an active online presence with integrated social media channels and customer review platforms such as Trustpilot. Technically, the website is built on the Magento 2 e-commerce platform, leveraging modern JavaScript libraries such as RequireJS and jQuery. It incorporates multiple third-party analytics and marketing tools including Google Analytics, Facebook Pixel, Bing Ads, and New Relic for performance monitoring. The site is mobile-optimized and demonstrates good SEO practices with proper meta tags and structured data. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect forms. However, some standard security headers like Content-Security-Policy and X-Frame-Options are not explicitly detected, suggesting an opportunity for improvement. No critical vulnerabilities or exposed sensitive data were found. Privacy and cookie policies are present and include consent mechanisms, indicating basic GDPR compliance. Overall, the website presents a trustworthy and professional front for AVS Fencing & Landscaping. The lack of WHOIS data due to domain registration issues is a concern but does not detract from the legitimacy of the business as evidenced by the detailed contact information and business presence. Strategic recommendations include enhancing security headers, improving incident response visibility, and continuing to monitor third-party scripts for vulnerabilities.

65
69
100
75
70
88
17
e-commercefencinglandscapingretailmagento+1 more
Magento 2RequireJSjQueryGoogle Tag Manager+5
2026-07-02T07:19:35.383Z
oceanbluesoftware.com favicon

Ocean Blue Software Ltd.

oceanbluesoftware.com

67
TechnologyUnited KingdommediumMEDIUM

Ocean Blue Software Ltd. is a UK-based company specializing in Smart TV and broadcast software services, including middleware development, testing, certification, and platform integration. Established in 2005, it serves a global clientele including TV operators, manufacturers, and silicon partners. The company positions itself as a trusted partner with over 20 years of industry experience and a strong presence in the broadcast and Smart TV ecosystem. Their website reflects a professional and modern digital presence built on Next.js and React frameworks, optimized for performance and mobile responsiveness. Privacy and cookie policies are implemented with consent mechanisms, indicating compliance with GDPR standards. However, direct contact information such as emails or phone numbers is not prominently displayed on the homepage, which may affect immediate customer engagement. Security posture is generally good with HTTPS enforced and cookie consent in place, but the absence of explicit security headers and incident response contacts suggests room for improvement. The WHOIS lookup for the domain failed due to a domain naming error, raising concerns about domain registration legitimacy, though the website content and branding strongly indicate a legitimate business. Overall, the site scores well on content quality, technical implementation, and privacy compliance, with recommendations to enhance security headers and provide clearer contact channels.

65
55
77
100
70
2
83
smarttvbroadcastmiddlewaresoftwaredevelopmenttesting+3 more
ReactNext.jsJavaScriptCSS+1
2026-07-02T07:19:08.029Z
V

Viking Tapes

vikingtapes.co.uk

71
E-commerceUnited KingdomsmallMEDIUM

Viking Tapes operates as a UK-based e-commerce retailer specializing in adhesive tapes and related products, prominently featuring 3M branded tapes, masking tapes, eco-friendly tapes, and glue dots. The website positions itself as a market leader in the UK online tape market, targeting both business and consumer customers. The business model is focused on direct online sales through a Shopify-powered platform, leveraging over 25 years of industry experience to provide expert advice and product offerings. Technically, the website is built on Shopify, utilizing modern analytics and marketing tools such as Google Analytics, Microsoft Clarity, Sendinblue, and Brevo, indicating a mature digital infrastructure. The site is mobile-optimized with good SEO and basic accessibility features, though there is room for improvement in accessibility compliance and security header implementation. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security policies and vulnerability disclosure information. WHOIS data for the queried domain 'www.vikingtapes.co.uk' is unavailable due to invalid query format; however, the website content and technical setup suggest a legitimate business. Overall, the site is professional, trustworthy, and safe for general audiences, with moderate risk due to incomplete WHOIS transparency and missing privacy policy documentation.

100
85
44
70
75
17
100
e-commerceadhesivetapes3mtapesmaskingtapesshopify+4 more
ShopifyGoogle AnalyticsGoogle Tag ManagerSendinblue+4
2026-07-02T07:18:57.311Z
ecipartners.com favicon

ECI Partners

ecipartners.com

61
FinanceUnited KingdommediumMEDIUM

ECI Partners is a growth-focused private equity firm specializing in supporting European businesses valued between £50 million and £350 million. The company positions itself as a strategic partner for growth, providing investment and support to mid-market businesses. The website reflects a professional and consistent brand image, targeting corporate clients in the finance sector primarily within the UK and Europe. The business model centers on private equity investment and partnership, aiming to foster growth in its portfolio companies. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Tag Manager, Cookiebot for consent management, HubSpot and Pardot for marketing automation, and Hotjar for user behavior analytics. The site is hosted likely on WP Engine, indicating a managed hosting environment optimized for WordPress. The website demonstrates good SEO, accessibility, and mobile optimization, providing a positive user experience. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms, indicating awareness of privacy regulations. However, there is no explicit privacy policy or terms of service detected in the provided content, nor is there a security.txt or vulnerability disclosure page. WHOIS data is unavailable, which reduces trustworthiness from a domain registration perspective. No contact emails or phone numbers are explicitly provided, limiting direct communication channels. Overall, the website is professional and well-constructed but would benefit from enhanced transparency regarding privacy, security policies, and incident response contacts. The absence of WHOIS data is a concern but may be due to privacy protection or registry issues. Strategic recommendations include publishing clear privacy and terms policies, adding security contact information, and maintaining regular security audits of third-party scripts and integrations.

57
80
65
100
10
83
15
privateequityfinanceinvestmentgrowthbusiness+3 more
jQueryGoogle Tag ManagerCookiebotHubSpot+3
2026-07-02T07:18:40.251Z
chapmanbdsp.com favicon

chapmanbdsp

chapmanbdsp.com

53
EnergyN/amediumMEDIUM

chapmanbdsp is an independent design consultancy specializing in building services engineering and environmental design, with a focus on sustainable and integrated solutions. The company highlights a global footprint with projects across 32 countries and over 50 years of experience, positioning itself as a reputable player in the energy and real estate sectors. Their key services include building services engineering, environmental sustainability, vertical transportation, advisory, and smart building consultancy. The website reflects a professional and consistent brand image targeting architects, developers, and sustainability-conscious clients. Technically, the website employs modern web technologies such as Google Tag Manager and polyfills for compatibility, with a responsive design optimized for mobile devices. The site loads moderately fast and includes SEO best practices with proper meta tags and structured navigation. However, no CMS or hosting provider details are evident, and security headers are not explicitly present in the provided data. From a security perspective, the site uses HTTPS, ensuring encrypted communications, and does not expose sensitive data or vulnerable libraries. However, the absence of security headers, privacy and cookie policies, and incident response information indicates room for improvement in security posture and compliance. The WHOIS data is missing, raising concerns about domain registration legitimacy and consistency with the company's claimed history. Overall, the website is professional and trustworthy in appearance but would benefit from enhanced transparency in privacy, security policies, and domain registration details to strengthen trust and compliance.

60
35
2
85
64
85
20
buildingservicesenvironmentaldesignsustainabilityengineeringconsultancynetzero+1 more
Google Tag ManagerPolyfill.ioTiny Slider (tns)SVG icons
2026-07-02T07:18:13.983Z
kingstonrecruitment.co.uk favicon

Kingston Recruitment Ltd

kingstonrecruitment.co.uk

46
OtherUnited KingdomsmallHIGH

Kingston Recruitment Ltd is a well-established recruitment agency based in Hull, East Yorkshire, specializing in office and commercial recruitment services including temporary, contract, and permanent placements. Founded in 1985, the company serves both candidates and clients with a strong regional presence and a reputation for quality service. The website reflects a professional business model focused on staffing solutions for a variety of sectors. Technically, the website employs a modern frontend stack including Bootstrap, jQuery, Owl Carousel, and integrates live chat via Tawk.to and analytics through Google Analytics and Tag Manager. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. Security posture is moderate; HTTPS is implied but no security headers were detected in the provided data, and no explicit security or incident response policies are published. Privacy compliance is basic with a privacy policy present but lacking cookie consent mechanisms. WHOIS data could not be retrieved due to domain naming issues, which raises concerns about domain registration consistency but does not directly impact the legitimacy of the business as presented on the site. Overall, the website is professional and trustworthy but would benefit from enhanced security and privacy practices.

70
65
20
57
15
17
53
recruitmentjobsemploymenthulleastyorkshire+3 more
jQueryBootstrapOwl CarouselPrettyPhoto+2
2026-07-02T07:18:08.585Z
ukelectronics.co.uk favicon

UK Electronics

ukelectronics.co.uk

52
ManufacturingUnited KingdommediumMEDIUM

UK Electronics is a well-established UK-based contract electronic manufacturer specializing in high-quality electronic assemblies, PCB assembly, and box build services. With over 40 years of experience, the company serves diverse sectors including military, aviation, and medical, offering a full turnkey manufacturing solution. Their UK-based facility emphasizes quality, traceability, and responsive communication, supported by multiple industry certifications such as ISO 9001, ISO 14001, and IPC standards. The website reflects a professional and comprehensive digital presence with clear service offerings and strong trust indicators. Technically, the website is built on WordPress with modern technologies including jQuery and Google Analytics GA4 for tracking. SEO and accessibility are well addressed, though some improvements in security headers and accessibility could be made. The site uses HTTPS with a cookie consent mechanism, indicating good privacy compliance. No WAF or blocking mechanisms were detected, allowing full content access. Security posture is solid with HTTPS and no exposed sensitive data, but the absence of explicit security headers and incident response information suggests room for enhancement. The WHOIS lookup for the exact subdomain failed due to naming rules, but this is a known limitation when querying subdomains rather than the registered domain. Overall, the domain and website appear legitimate and trustworthy. Recommendations include implementing additional security headers, publishing a vulnerability disclosure policy, enhancing accessibility features, and maintaining regular audits of third-party scripts to sustain security and compliance standards.

70
20
47
85
73
17
15
electronicsmanufacturingukpcbassemblycontractmanufacturing+2 more
jQuery 3.3.1Google Analytics GA4Yoast SEO pluginSlick Slider+1

Partner Domains:

bc-design.co.uk
partner
2026-07-02T07:17:57.774Z
am-energy.com favicon

A&M Energy Solutions

am-energy.com

66
EnergyUnited KingdommediumMEDIUM

A&M Energy Solutions is a UK-based medium-sized company specializing in the supply and installation of loft and cavity wall insulation products for homeowners, contractors, local authorities, and landlords. The company positions itself as a reliable energy-saving insulation contractor with multiple depots across the UK, offering bespoke solutions to improve energy efficiency and reduce energy bills. Their website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their target audiences. Technically, the website is built on WordPress using common plugins such as Gravity Forms and Yoast SEO, with integrations for Google Analytics, Google Tag Manager, Hotjar, and Trustpilot for customer reviews. The site is mobile-optimized and includes GDPR-compliant cookie consent mechanisms. However, the use of an outdated jQuery version and lack of advanced security headers indicate areas for technical improvement. From a security perspective, the site enforces HTTPS and uses a consent management platform, but lacks visible security headers and incident response contact information. The absence of WHOIS registration data raises concerns about domain legitimacy, although the website content and business information appear credible. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website scores well on content quality, privacy compliance, and business credibility but could enhance its security posture and domain transparency. Strategic recommendations include updating technical components, implementing additional security headers, and publishing vulnerability disclosure information to strengthen trust and security culture.

32
85
85
100
65
80
2
energyinsulationloftinsulationcavitywallinsulationenergysaving+5 more
jQuery 1.12.4Gravity Forms pluginYoast SEO pluginGoogle Tag Manager+6
2026-07-02T07:16:57.330Z
formwork.co.uk favicon

Special Formwork

formwork.co.uk

39
ManufacturingUnited KingdomsmallHIGH

Special Formwork is a UK-based specialist company focused on the design and manufacture of bespoke steel formwork systems for concrete casting, serving the construction and infrastructure sectors. The company positions itself as a leading UK provider with a strong emphasis on quality and innovation, targeting construction companies and civil engineers. Their product portfolio includes column formwork, tunnel and shaft formwork, sea defence solutions, and construction equipment fabrication. The website reflects a professional and consistent brand image aligned with their business focus. Technically, the website is built on WordPress using modern plugins and themes such as Yoast SEO, WPBakery Page Builder, and MonsterInsights for analytics. The site is mobile-optimized with good SEO practices and moderate performance. Security measures include HTTPS enforcement and standard security headers, although some improvements could be made in cookie consent and published security policies. The security posture is solid with no evident vulnerabilities or exposed sensitive data. However, the absence of a visible cookie consent mechanism and lack of published incident response or vulnerability disclosure policies indicate areas for compliance enhancement. The WHOIS data for the domain is unavailable due to a naming rules error, which limits domain legitimacy verification but does not detract from the professional presentation of the website. Overall, the website presents a trustworthy and professional digital presence for Special Formwork, with recommendations to improve privacy compliance and security transparency to further strengthen trust and regulatory adherence.

27
55
55
20
40
35
2
steelformworkconstructionmanufacturingukbespokedesign+2 more
WordPressPHPjQueryGoogle Analytics+4
2026-07-02T07:16:51.748Z
boningale.co.uk favicon

Boningale Ltd.

boningale.co.uk

47
OtherUnited KingdomlargeHIGH

Boningale Ltd. operates one of the UK’s largest horticultural businesses, specializing in large scale nursery production and plant supply across multiple divisions. The company targets industry professionals and large projects within the horticulture and landscape sectors. Their business model focuses on multi-site production, contract growing, and a webshop for plant sales, positioning them as a key player in the UK horticulture market. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress 7.0 with modern plugins such as Yoast SEO and Google Tag Manager integration. The site is mobile-optimized and uses asynchronous loading for analytics scripts, indicating a moderate to good digital maturity. However, some accessibility features could be improved, and hosting details remain unknown. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks important security headers and does not publish a security policy or incident response contacts. The absence of a cookie consent mechanism also indicates partial GDPR compliance. The WHOIS data is unavailable and shows an error from the registry, which raises concerns about domain registration legitimacy despite the professional website presence. Overall, the site presents a low risk to users and appears trustworthy for business purposes, but the domain registration anomaly should be investigated further. Strategic improvements in security headers, privacy compliance, and transparency would enhance trust and reduce potential risks.

57
65
40
70
2
15
53
horticulturenurseryplantsukbusinessprofessional+2 more
WordPress 7.0Yoast SEO pluginjQuery 3.7.1Google Tag Manager+2
2026-07-02T07:16:03.640Z
ethitec.com favicon

Ethical Technology Ltd t/a Ethitec

ethitec.com

69
HealthcareUnited KingdomsmallMEDIUM

Ethitec, trading as Ethical Technology Ltd, is a UK-based software company established in 1975 specializing in healthcare and public sector software solutions. Their flagship products include ELMS2, a community equipment management system, and Tiara9, a clinical management system widely used by NHS and allied health professionals. The company positions itself as a trusted provider with a strong focus on quality, evidenced by ISO 9001:2015 and Cyber Essentials Plus certifications. Their target audience includes public sector organizations, healthcare providers, and private sector clients requiring bespoke software solutions. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and uses Google Analytics and reCAPTCHA for tracking and security. The site is mobile-optimized with good navigation and content quality. However, some security best practices like security headers are missing, and WHOIS data for the domain is unavailable, which slightly reduces transparency. Security posture is solid with HTTPS enforced, privacy and cookie consent mechanisms in place, and certifications that indicate a mature security approach. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is good with GDPR-aligned policies and consent management. Business credibility is high due to clear contact information, certifications, and professional content. Overall, Ethitec presents a professional and trustworthy online presence with room for improvement in domain transparency and security headers. Strategic recommendations include publishing security headers, adding incident response contacts, and maintaining up-to-date software to enhance security and trust.

37
80
100
85
70
65
47
healthcaresoftwarenhsclinicalmanagementcommunityequipment+2 more
WordPress 5.7.15jQuery 3.5.1BootstrapGoogle Analytics+3

Partner Domains:

8foldgovernance.com
partner
2026-07-02T07:15:20.678Z
baltic.art favicon

BALTIC Centre for Contemporary Art

baltic.art

66
Non-profitUnited KingdommediumMEDIUM

Baltic Centre for Contemporary Art is a well-established non-profit cultural institution located in the United Kingdom, focused on contemporary art exhibitions, events, and community engagement. The website reflects a mature digital presence with comprehensive content, clear navigation, and strong branding consistency. It serves a broad audience including art enthusiasts, local communities, families, and visitors. The business model emphasizes free public access to art and cultural experiences, supplemented by venue hire and retail services. Technically, the website employs modern web technologies such as jQuery, Swiper.js, and Litepicker, integrated with analytics and marketing tools including Google Analytics, Facebook Pixel, and Hotjar. The site is built on a proprietary CMS (You.Create by Grandad Digital) and demonstrates good mobile optimization and accessibility features, including the ReciteMe accessibility tool. From a security perspective, the site uses HTTPS with strong SSL configuration but lacks explicit security headers and a published security policy or incident response plan. The domain WHOIS data is transparent and consistent with the organization's identity, enhancing trustworthiness. Privacy and cookie policies are present and GDPR compliant, with an active consent mechanism. Overall, Baltic.art presents a professional, secure, and user-friendly platform that aligns well with its mission as a non-profit art centre. Strategic improvements in security headers and incident response transparency could further enhance its security posture and stakeholder confidence.

70
70
47
100
65
83
2
artcontemporaryartgalleryculturenon-profit+3 more
jQuery 3.6.1LitepickerSwiper.jsGoogle Analytics (GA4 and Universal Analytics)+3

Partner Domains:

shop.balticmill.com
partner
archive.baltic.art
partner

+2 more partners

2026-07-02T07:14:15.945Z