Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157326
Websites
130
Industries
113
Countries
52
Avg Score
Page 120 of 3147|Showing 5951-6000 of 157326
P

PeoplesBank

bankatpeoples.com

67
FinanceUnited StatesmediumMEDIUM

PeoplesBank is a regional mutual community bank serving personal and business customers primarily in Western Massachusetts and Northern Connecticut. The bank offers a comprehensive range of financial services including personal and business checking and savings accounts, mortgage and home equity loans, business lending, cash management, and wealth management services. The website reflects a well-established financial institution with a strong local presence and community focus. The bank positions itself as a trusted local banking partner with a mutual ownership structure, emphasizing customer service and community involvement. Technically, the website employs a modern technology stack including jQuery, Bootstrap, and multiple analytics and advertising tracking tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is mobile optimized, accessible, and SEO friendly with proper metadata and structured navigation. Performance is moderate with good user experience and professional design quality. From a security perspective, the site enforces HTTPS, uses frame busting to prevent clickjacking, and provides cookie consent mechanisms. However, it lacks some advanced security headers and publicly available security or incident response policies. The WHOIS data for the domain is unavailable, which is unusual for a bank and slightly reduces trust, but the presence of regulatory trust seals and consistent branding supports legitimacy. Overall, PeoplesBank's website demonstrates a mature digital presence with good security hygiene and comprehensive service offerings. Strategic improvements in transparency around security policies and WHOIS data disclosure would enhance trust and compliance posture.

85
100
70
72
75
53
2
bankpersonalbankingbusinessbankingmortgagehomeloans+3 more
jQueryBootstrapGoogle Tag ManagerFacebook Pixel+9

Partner Domains:

bankatpeoples.mymortgage-online.com
partner
onboard.bankatpeoples.com
service

+1 more partners

2026-07-04T07:22:15.008Z
M

Mayo Foundation for Medical Education and Research

mayo.edu

60
HealthcareUnited StatesenterpriseMEDIUM

Mayo Clinic is a globally recognized non-profit healthcare organization specializing in patient care, medical research, and education. The website focuses on education and research opportunities, highlighting Mayo Clinic's integrated approach to improving patient outcomes through academic and scientific collaboration. The institution serves a broad audience including patients, medical professionals, students, and researchers, positioning itself as a leader in healthcare innovation and education. Technically, the website employs modern JavaScript libraries, tag management, and performance monitoring tools, hosted likely on Akamai's infrastructure, ensuring fast load times and good mobile responsiveness. Accessibility and SEO best practices are well implemented, contributing to an excellent user experience. From a security perspective, the site enforces HTTPS, uses secure form handling, and integrates consent management for privacy compliance. While explicit security headers are not fully confirmed, the overall posture is strong with no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data is noted but likely due to .edu domain registration policies rather than malicious intent. Overall, the website demonstrates a high level of professionalism, trustworthiness, and compliance with privacy regulations, making it a reliable resource for its users.

70
85
37
100
73
17
15
healthcareeducationresearchmedicalclinicaltrials+1 more
JavaScriptjQuery UI AutocompleteOwl CarouselTealium Tag Management+2
2026-07-04T07:21:43.360Z
fosterfarms.com favicon

Foster Farms

fosterfarms.com

64
RetailUnited StateslargeMEDIUM

Foster Farms is a well-established poultry company specializing in premium chicken and turkey products, targeting general consumers seeking fresh, natural, and organic protein options. The company maintains a strong market presence on the West Coast of the United States, offering a range of fresh whole chickens and ready-to-eat meals. Their website reflects a mature digital presence with professional branding and consistent messaging aligned with their business model. Technically, the website is built on WordPress with integration of modern marketing and analytics tools such as Google Tag Manager and Bazaarvoice. The site is mobile-optimized and employs SEO best practices, although some accessibility features could be enhanced. Performance is moderate, with no significant technical debt observed. From a security perspective, the site enforces HTTPS and includes standard security headers, contributing to a good security posture. However, there is a lack of publicly available security policies, incident response contacts, and vulnerability disclosure mechanisms, which are recommended for improving transparency and trust. Privacy compliance is strong, with clear privacy and cookie policies and a consent mechanism in place. Overall, the website presents a low-risk profile with good business credibility and technical implementation. The main limitation is the absence of WHOIS data, which reduces domain registration trust verification. Strategic recommendations include publishing security policies, adding incident response information, and enhancing accessibility and security transparency.

80
100
47
85
65
2
53
poultryfoodretailorganicchicken+5 more
WordPressYoast SEOGoogle Tag ManagerBazaarvoice+1
2026-07-04T07:21:22.296Z
arnoldclarkrental.com favicon

Arnold Clark Finance Limited

arnoldclarkrental.com

62
TransportationUnited KingdomlargeMEDIUM

Arnold Clark Car & Van Rental operates a comprehensive vehicle rental service across over 30 locations in Scotland and England, offering cars, vans, dual control vehicles, and luxury options. The company positions itself as a trusted and established player in the UK transportation rental market, supported by awards such as the Which? Recommended Provider and BVRLA accreditation. Their website provides a professional, user-friendly booking experience with clear pricing and extensive location coverage. Technically, the website employs modern technologies including Google Tag Manager, LivePerson chat, Trustpilot integration, and a robust cookie consent management system. The site is mobile-optimized, accessible, and SEO-friendly, providing a smooth user experience. Security is well-handled with HTTPS enforcement and secure form submissions, though some security headers could be improved. From a security perspective, the site shows good practices in privacy compliance and data protection, with clear cookie consent and privacy policies aligned with GDPR. However, the absence of WHOIS data raises a minor concern that should be investigated further to confirm domain registration legitimacy. No critical vulnerabilities or exposed sensitive data were detected. Overall, Arnold Clark Car & Van Rental presents a secure, trustworthy, and professional online presence suitable for its business model. Strategic improvements in security headers and incident response transparency would further enhance their security posture and customer trust.

85
100
42
65
2
68
55
carhirevanhirevehiclerentaluktransportation+7 more
Google Tag ManagerLivePerson ChatTrustpilot WidgetsCookieControl Consent Management+1

Partner Domains:

arnoldclark.com
partner
2026-07-04T07:20:56.038Z
tsg.je favicon

Total Solutions Group (TSG) Jersey

tsg.je

61
TechnologyJerseymediumMEDIUM

Total Solutions Group (TSG) Jersey is a leading information management and technology services provider based in Jersey, serving clients across the Channel Islands, UK, Gibraltar, Mauritius, and South Africa. The company offers a broad range of services including document management, scanner hardware support, robotic process automation, GDPR consultancy, and information security. Their market position is strong regionally, supported by partnerships with recognized technology providers such as Kofax and Mitratech. The website reflects a professional business model focused on B2B services with clear contact channels and trust indicators such as Cyber Essentials certification. Technically, the website is built on WordPress using modern plugins like WPBakery Page Builder and LayerSlider. It employs HTTPS with good SSL configuration and includes responsive design elements for mobile optimization. However, some technical improvements are recommended, including the implementation of security headers and proper configuration of analytics tools. The website's performance is moderate with basic SEO and accessibility features. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and no visible sensitive data exposure. The presence of Cyber Essentials certification indicates a commitment to security standards. However, the absence of security headers and lack of an incident response or vulnerability disclosure policy are areas for improvement. Privacy compliance is partially met with privacy and cookie policies present, but the lack of a cookie consent mechanism reduces compliance confidence. Overall, the website is trustworthy, professional, and well-positioned in its market niche. Strategic recommendations include enhancing security headers, implementing cookie consent, configuring analytics properly, and publishing explicit security and incident response policies to strengthen compliance and trust.

62
70
72
20
80
55
47
informationmanagementtechnologyservicesconsultancydocumentmanagementroboticprocessautomation+2 more
WordPressPHPjQueryLayerSlider+4

Partner Domains:

kofax.com
partner
mitratech.com
partner
2026-07-04T07:20:06.691Z
express-exports.co.uk favicon

Express Export Services

express-exports.co.uk

52
TransportationUnited KingdomsmallMEDIUM

Express Export Services Limited is a UK-based international shipping and logistics company with over 50 years of experience. The company offers a broad range of services including parcel delivery, pallet and crate shipping, container shipping, vehicle shipping, international removals, antiques and artwork shipping, oversized cargo handling, professional packing, and customs/documentation assistance. Their target audience includes individuals, families, and businesses requiring reliable and secure international shipping solutions. The website presents a professional and consistent brand image with clear navigation and comprehensive service descriptions. Technically, the website employs modern frontend technologies such as Bootstrap, jQuery, and Owl Carousel, ensuring good mobile responsiveness and user experience. The site uses Google reCAPTCHA to protect forms from spam. However, there is no evidence of advanced security headers or cookie consent mechanisms, which are important for GDPR compliance and security hardening. From a security perspective, the website is accessible without WAF or blocking mechanisms, but lacks several security best practices such as security headers and explicit incident response contacts. The WHOIS data for the domain is unavailable due to a domain registration error indicating the domain name contains too many parts and cannot be registered, which raises concerns about domain legitimacy and ownership consistency. Overall, the website is professional and functional with good content quality and business credibility. However, the domain registration anomaly and missing security headers reduce the overall trust score. Strategic improvements in domain registration verification, security header implementation, and privacy compliance are recommended to enhance trust and security posture.

27
70
60
100
2
35
53
internationalshippingfreightforwardinglogisticsparceldeliveryvehicleshipping+2 more
BootstrapjQueryjQuery bxSliderOwl Carousel+4
2026-07-04T07:19:50.891Z
mrkservices.co.uk favicon

MRK Services

mrkservices.co.uk

62
ManufacturingUnited KingdomsmallMEDIUM

MRK Services is a small, family-run UK business specializing in powder coating, blast cleaning, automotive restoration, and garden furniture restoration services. Established in 1990, the company emphasizes quality, service, and experience, targeting both consumer and business clients seeking surface preparation and restoration solutions. The website reflects a professional and consistent brand image with clear service offerings and customer testimonials, positioning MRK Services as a trusted local specialist in their industry. Technically, the website is built on the HubSpot CMS platform, leveraging modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA Enterprise for security and analytics. The site is mobile-optimized with good navigation and SEO practices, though some accessibility features could be enhanced. Performance is moderate, with room for optimization. Security posture is solid with HTTPS enforced and anti-bot measures in place, but lacks explicit security headers such as CSP and X-Frame-Options. Privacy compliance is partial; a cookie consent banner is present, but no explicit privacy policy or terms of service pages were detected in the provided content. Contact information is clearly presented, enhancing business credibility. Overall, the website is trustworthy and professional, but domain registration details are unavailable due to WHOIS query issues, which slightly impacts trust assessment. Strategic improvements in privacy documentation and security headers would strengthen compliance and security posture.

60
100
70
39
17
45
83
powdercoatingblastcleaningautomotiverestorationgardenfurniturerestorationfamilybusiness+2 more
HubSpot CMSGoogle AnalyticsGoogle Tag ManagerreCAPTCHA Enterprise+1
2026-07-04T07:18:36.948Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
rjevansroofing.com favicon

RJ Evans Flat Roofing Limited

rjevansroofing.com

52
Real EstateUnited KingdommediumMEDIUM

RJ Evans Flat Roofing Limited is a UK-based commercial roofing contractor specializing in engineered roofing systems for commercial and industrial buildings nationwide. The company offers a comprehensive range of services including installation, repair, inspection, and maintenance of flat and low-slope roofing systems tailored to meet UK regulatory and environmental demands. Their market position is strong, supported by multiple industry accreditations and positive customer testimonials, targeting commercial property owners and facilities managers across the UK. Technically, the website employs modern web technologies such as Google Analytics, Bootstrap, and hCaptcha, indicating a moderate to advanced digital maturity. The site is well-structured, mobile-optimized, and SEO-friendly, though some improvements in accessibility and security headers could enhance its technical posture. From a security perspective, the site benefits from HTTPS and form protection via hCaptcha, alongside cookie consent mechanisms supporting GDPR compliance. However, the absence of visible security headers and lack of explicit incident response or security policy pages suggest areas for improvement. The missing WHOIS data introduces some uncertainty regarding domain registration legitimacy, though the website content and trust signals mitigate this concern. Overall, RJ Evans presents a professional and trustworthy online presence with solid business credibility and technical implementation. Strategic enhancements in security practices and domain registration transparency would further strengthen their security posture and trustworthiness.

57
60
-
85
68
40
25
commercialroofingflatroofingroofingcontractorwaterproofingukroofing+2 more
Google AnalyticsGoogle Tag ManagerhCaptchajQuery+3
2026-07-04T07:17:54.656Z
agencyspace.co.uk favicon

Agencyspace

agencyspace.co.uk

43
MediaUnited KingdomsmallHIGH

Agencyspace is a well-established independent global creative company specializing in advertising, content creation, and experiential marketing. The company positions itself as a forward-thinking agency that helps brands go beyond conventional marketing approaches to become distinctive and memorable. The website reflects a professional and consistent brand image with clear messaging targeted at ambitious brands seeking innovative marketing solutions. The company operates primarily in the media sector and is based in the United Kingdom, with a domain age indicating a mature business presence since 2003. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and integrates Google Analytics and Tag Manager for tracking. The site demonstrates good mobile optimization, SEO practices, and moderate performance. However, some accessibility features could be improved. Security-wise, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the security posture is adequate but could be enhanced by implementing security headers, cookie consent, and incident response information. The business credibility is high due to clear contact information, professional design, and consistent branding. There are no indications of malicious or adult content, making the site safe for general audiences. The domain registration data supports the legitimacy of the business with consistent and transparent WHOIS information. Strategic recommendations include improving privacy compliance with cookie consent, adding security headers, publishing security and incident response policies, and maintaining regular updates to WordPress and plugins to mitigate vulnerabilities.

70
47
75
-
15
2
53
creativeagencyadvertisingbrandingmediamarketing+1 more
WordPress 7.0Yoast SEO pluginjQueryGoogle Analytics+4
2026-07-04T07:17:49.347Z
edmonds-accountancy.co.uk favicon

Edmonds Accountancy Ltd.

edmonds-accountancy.co.uk

48
FinanceUnited KingdomsmallHIGH

Edmonds Accountancy Ltd. is a professional accountancy firm based in Reading, Berkshire, UK, offering a wide range of accounting and business advisory services tailored to both businesses and individuals. The company emphasizes client support, transparency with no hidden fees, and expertise in areas such as VAT returns, payroll, self-assessments, and cloud accounting. Their market position is that of a local, approachable, and trusted accounting partner with a strong focus on client relationships and business growth support. Technically, the website is built on WordPress and leverages modern web technologies including jQuery, Gravity Forms for data collection, Google Analytics, Google Tag Manager, Microsoft Clarity, Facebook Pixel for tracking, and Google reCAPTCHA v3 for form security. The site is mobile-optimized, accessible, and SEO-friendly, with a professional design and clear navigation. From a security perspective, the website enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit security headers such as Content-Security-Policy and X-Frame-Options, which could enhance protection. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms. Overall, the website presents a low-risk profile with strong business credibility and good technical implementation. The main concern is the failure to retrieve WHOIS data due to domain naming rules issues, which limits verification of domain legitimacy. Strategic recommendations include improving security headers, verifying domain registration status, and publishing a security policy to enhance trust and compliance.

57
20
70
60
15
17
68
accountancyaccountantsbusinessadvicefinancereading+5 more
jQueryGravity FormsGoogle AnalyticsGoogle Tag Manager+3
2026-07-04T07:16:51.457Z