Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149091
Websites
130
Industries
113
Countries
52
Avg Score
Page 103 of 120|Showing 5101-5150 of 5967
teemusk.com favicon

Tanel Teemusk

teemusk.com

47
TechnologyEstoniasmallHIGH

The website teemusk.com represents a seasoned freelance iOS developer and technical team lead, Tanel Teemusk, showcasing his portfolio, resume, and contact information. The site targets businesses and clients seeking expert iOS development and technical leadership services. The business model is freelance consultancy with a strong emphasis on technical expertise and project leadership. The website is professionally designed using WordPress with Divi Builder and SEO optimizations, providing a good user experience and clear navigation. Social media presence is leveraged for contact and trust building. Technically, the site employs modern web technologies including HTTPS, Google Analytics, and Google reCAPTCHA for security and analytics. The CMS is WordPress, with plugins enhancing SEO and form functionality. Performance is moderate with good mobile optimization. However, some security best practices such as DNSSEC and security headers are missing, which could be improved. Security posture is solid with HTTPS and anti-bot measures, but lacks published security or privacy policies, which impacts privacy compliance. No direct company emails or phone numbers are disclosed, relying on contact forms and social media. The domain registration data is consistent with the business claims, showing a long-standing domain without privacy protection, supporting legitimacy. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security hardening to improve user trust and regulatory adherence.

20
35
17
55
72
80
20
portfolioiosdeveloperfreelancetechleadsoftwaredevelopment+2 more
WordPressPHPJavaScriptjQuery+2
2025-06-25T17:07:52.112Z
ryapolov.com favicon

Afternic (GoDaddy Operating Company, LLC)

ryapolov.com

70
TechnologyUnited StateslargeMEDIUM

The website ryapolov.com is a domain sales landing page hosted on the Afternic platform, a domain aftermarket service owned by GoDaddy Operating Company, LLC. It offers the domain ryapolov.com for sale with options to buy outright or lease to own. The site targets domain buyers including businesses and individuals seeking premium domain names. The business model is focused on domain brokerage and sales, leveraging GoDaddy's extensive infrastructure and brand recognition. The platform provides contact forms and phone support to facilitate domain price inquiries and transactions. Technically, the site is built using modern web technologies including React and Next.js, hosted on Amazon AWS infrastructure. It employs HTTPS with strong security headers and integrates third-party services such as Klarna for payments and Trustpilot for reputation. The site is optimized for performance and mobile responsiveness, with good SEO and basic accessibility features. Privacy and cookie policies are comprehensive and GDPR compliant, reflecting a mature digital presence. From a security perspective, the website demonstrates strong posture with enforced HTTPS, secure forms protected by reCAPTCHA, and no visible vulnerabilities or exposed sensitive data. However, it lacks explicit security policy documentation and incident response contact information, which are recommended for enhanced trust and compliance. The absence of WHOIS data for the domain reduces transparency but is likely due to privacy protection or query limitations. Overall, the site is legitimate, professional, and secure, suitable for its domain sales purpose. The overall risk assessment is low, with recommendations to improve transparency by publishing security policies and incident response details, enhancing accessibility, and maintaining regular audits of third-party scripts. These steps will further strengthen trust and compliance in the competitive domain aftermarket space.

65
50
17
75
100
70
100
domainsalesdomainmarketplaceafternicgodaddydomainforsale+5 more
ReactNext.jsJavaScriptCSS+2

Partner Domains:

godaddy.com
partner
trustpilot.com
partner
2025-06-25T17:07:51.186Z
eliko.ee favicon

Eliko Location Technologies OU

eliko.ee

61
TechnologyEstoniamediumMEDIUM

Eliko Location Technologies OU is a technology company specializing in next-generation location tracking solutions based on ultra-wideband (UWB) technology. Their website presents a mature and professional digital presence, highlighting their RTLS products, case studies with reputable clients such as Bosch, and a strong emphasis on accuracy, reliability, and tailored solutions for industrial and immersive applications. The company targets machine builders, enterprise software providers, and manufacturing operations, positioning itself as a trusted provider with over 200 companies relying on their technology. Technically, the website is built on WordPress and leverages modern web technologies including Google Analytics, Google Tag Manager, and Google reCAPTCHA for security and analytics. The site is well-optimized for performance, mobile responsiveness, and accessibility, with comprehensive SEO metadata and structured data enhancing search visibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to protect forms, and implements a cookie consent mechanism, demonstrating awareness of privacy and security best practices. However, explicit privacy policies, terms of service, and security policies are not found, representing areas for improvement. DNSSEC is not enabled, which could enhance DNS security. Overall, the security posture is good but could be strengthened with more explicit documentation and technical controls. The domain WHOIS data aligns well with the website content, showing consistent registrant information and appropriate domain age, supporting the legitimacy of the business. No WAF or blocking mechanisms were detected, allowing full content access and analysis. Strategically, Eliko is well-positioned in the RTLS market with a solid technical foundation and trusted customer base. Enhancing transparency around privacy, security policies, and incident response would further strengthen trust and compliance posture.

75
68
17
85
72
70
20
locationtrackinguwbrtlstechnologyindustrial+1 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAGravity Forms+3
2025-06-25T17:07:51.104Z
deltaheroes.com favicon

DeltaHeroes OÜ

deltaheroes.com

42
TechnologyEstoniasmallHIGH

DeltaHeroes OÜ is a small Estonian consulting firm specializing in strategic partnership consulting, focusing on connecting Asia-Pacific with Estonian technology companies. Their core business involves investment scouting, matchmaking between startups and enterprises, organizing business delegations, and conducting seminars on corporate innovation and strategic investment. The company positions itself as a bridge between the Baltic and Asian regions, targeting entrepreneurs, investors, and enterprises interested in cross-regional collaboration. Technically, the website employs modern web technologies including Google reCAPTCHA for form security, Google Tag Manager for analytics, and lazy loading for images to optimize performance. The site is mobile-optimized with good navigation and SEO practices. Hosting appears to be managed via NameCheap, consistent with the domain registrar information. From a security perspective, the website enforces HTTPS and uses CAPTCHA on its contact form, which are positive indicators. However, it lacks explicit security headers and does not provide privacy or cookie policies, which are important for GDPR compliance and user trust. No incident response or vulnerability disclosure information is available, representing an area for improvement. Overall, the website is professional and credible with consistent WHOIS data and clear business information. The main risks relate to privacy compliance and security hardening. Strategic recommendations include publishing privacy and cookie policies, implementing security headers, and establishing vulnerability disclosure mechanisms to enhance trust and compliance.

15
35
17
40
52
75
40
estoniacryptocurrencyblockchainconsultingbusiness+3 more
Google reCAPTCHAGoogle Tag ManagerGoogle Fontslozad.js (lazy loading)+3

Partner Domains:

pipedrive.com
partner
cyber.ee
partner

+3 more partners

2025-06-25T17:07:50.859Z
traff.co favicon

TRAFF OÜ

traff.co

53
TechnologyEstoniamediumMEDIUM

TRAFF OÜ operates a sophisticated online marketing platform that connects advertisers and publishers through its proprietary AdExchange system. The company focuses on delivering targeted advertising solutions using advanced audience analytics, campaign optimization, and a variety of digital marketing tools. Positioned as a medium-sized technology company based in Estonia, TRAFF OÜ serves a global audience with a strong emphasis on quality traffic and conversion metrics. The website reflects a professional and consistent brand image with comprehensive service offerings and clear contact channels. Technically, the website employs modern web technologies including jQuery, Google Analytics, Yandex Metrika, and Google reCAPTCHA to ensure both functionality and security. The site is mobile-optimized and demonstrates good SEO practices, although some improvements in accessibility and security headers could enhance its posture. The presence of multiple analytics and tracking tools indicates a moderate level of user tracking balanced with privacy compliance measures. From a security perspective, the site uses HTTPS exclusively and integrates CAPTCHA for form submissions, reducing the risk of automated abuse. However, the absence of explicit security headers and incident response information suggests room for improvement in security maturity. The WHOIS data is privacy protected, which is common for this business type, and the website provides sufficient company information to establish legitimacy. Overall, TRAFF OÜ presents a credible and professional online marketing platform with a solid technical foundation and good privacy compliance. Strategic enhancements in security policies and transparency could further strengthen trust and resilience against emerging threats.

15
65
2
85
72
80
20
onlinemarketingadvertisingplatformadexchangedigitalmarketingtrafficmonetization+2 more
jQueryGoogle AnalyticsGoogle reCAPTCHAYandex Metrika+3

Partner Domains:

advertiser.traff.co
service
2025-06-25T17:07:50.340Z
tjo.ee favicon

TJO Konsultatsioonid

tjo.ee

52
ManufacturingEstoniasmallMEDIUM

TJO Konsultatsioonid is a leading Estonian consulting firm specializing in management systems development, strategic management, and production efficiency enhancement. The company offers a range of consulting services and training programs targeted at businesses seeking to improve operational effectiveness and comply with international standards. Their market position is strong within Estonia, supported by multiple ISO certifications and a robust client base. The website infrastructure is built on WordPress, utilizing modern plugins such as Yoast SEO and Ninja Forms, integrated with Google Analytics and Google Tag Manager for performance and user behavior tracking. The site is mobile-optimized and demonstrates good SEO practices, contributing to a positive digital maturity profile. Security posture is solid with HTTPS enforced, use of Google reCAPTCHA on forms, and indications of security plugins like Wordfence. However, some security headers are not explicitly confirmed and could be improved. Privacy compliance is well addressed with a comprehensive privacy policy and cookie consent mechanism aligned with GDPR requirements. Overall, the website and business present a trustworthy and professional image with no critical security issues detected. Strategic recommendations include enhancing security headers, maintaining up-to-date software, and considering a formal incident response policy to further strengthen security and compliance.

85
10
17
65
62
70
20
consultingmanagementsystemsisocertificationstrainingestonia+1 more
WordPressYoast SEO pluginNinja FormsGoogle Analytics+5
2025-06-25T17:07:49.863Z
agrello.io favicon

Agrello

agrello.io

67
TechnologyEstoniasmallMEDIUM

Agrello is a technology company specializing in secure e-signature and contract management solutions tailored primarily for small and medium-sized enterprises (SMEs). The platform offers a comprehensive suite of services including document automation, bulk contract creation, and legally binding electronic signatures compliant with EU and UK regulations. Positioned as a time-saving and efficient alternative to manual contract workflows, Agrello emphasizes ease of use, security, and compliance. The company operates from Estonia and provides multilingual support, reflecting a focus on European markets. Technically, the website is built on modern web technologies including Webflow CMS, Google Fonts, and integrates analytics and marketing tools such as Microsoft Clarity and Google Tag Manager. The platform supports integrations via Zapier and offers API access, indicating a mature digital infrastructure. The site is well-optimized for performance, mobile responsiveness, and SEO, with clear navigation and professional design. From a security perspective, Agrello enforces HTTPS, uses reCAPTCHA for form protection, and implements cookie consent mechanisms. While explicit security headers are not fully documented in the HTML, the overall posture is strong with no visible vulnerabilities or exposed sensitive data. The WHOIS data is privacy protected, which is typical for SaaS providers, and the domain appears actively maintained. Overall, Agrello presents a trustworthy, professional, and technically sound online presence suitable for its target market. Strategic recommendations include enhancing transparency around security policies and incident response, and publishing vulnerability disclosure information to further build trust.

60
53
2
80
72
85
100
e-signaturecontractmanagementdocumentautomationsmelegaltech+1 more
Webflow CMSGoogle Fonts (Montserrat, Lato, Inter, Manrope)Google Tag ManagerMicrosoft Word template integration+5
2025-06-25T17:07:49.849Z
agrello.id favicon

Agrello

agrello.id

67
TechnologyEstoniasmallMEDIUM

Agrello is a technology company based in Estonia specializing in secure e-signature and contract management solutions tailored primarily for small and medium-sized enterprises. Their platform enables users to create, sign, and manage legally binding agreements efficiently, reducing contract signing time by up to 60%. The company offers a SaaS subscription model with tiered plans, including a free trial and custom enterprise options, positioning itself as a niche player in the legaltech space with compliance to EU and UK regulations such as eIDAS. Technically, Agrello's website is built on modern web technologies including Webflow CMS, Google Tag Manager, Microsoft Clarity, and integrates with popular tools like Zapier and Microsoft Word templates. The site is well-optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. Security measures include HTTPS enforcement, use of reCAPTCHA, and cookie consent mechanisms, although explicit security headers and a dedicated security policy page are not publicly evident. From a security posture perspective, the platform demonstrates strong adherence to best practices with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust, with clear privacy and cookie policies aligned with GDPR requirements. However, the absence of a public incident response or vulnerability disclosure page suggests room for improvement in transparency and security readiness. Overall, Agrello presents a trustworthy and professional online presence with a clear value proposition for SMEs seeking to streamline contract workflows. The domain WHOIS data is privacy protected, which is typical for SaaS providers, and does not raise immediate concerns. Strategic recommendations include enhancing security header implementation, publishing a security policy and incident response information, and providing DPO contact details to further strengthen compliance and trust.

60
53
2
80
72
85
100
e-signaturecontractmanagementsaasautomationsme+3 more
Webflow CMSGoogle Tag ManagerMicrosoft Word templates integrationZapier integration+2
2025-06-25T17:07:49.814Z
aksohaus.ee favicon

eHost OÜ

aksohaus.ee

40
FinanceEstoniasmallHIGH

Investor.ee is a small Estonian educational website focused on providing practical advice and information about investing, portfolio management, risk management, and financial knowledge. The site targets individuals and organizations interested in growing their capital through various investment strategies. The business operates primarily as a content and informational platform, with a niche focus on the Estonian-speaking investment community. The domain is registered to eHost OÜ since 2019, consistent with the website's scope and scale. Technically, the website is built on WordPress using a modern theme and standard libraries such as Bootstrap, jQuery, and FontAwesome. It integrates Google Tag Manager for analytics and Google reCAPTCHA v3 for spam protection on forms. The site is hosted behind Cloudflare DNS and uses HTTPS, ensuring secure communication. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms. However, it lacks explicit security headers like Content-Security-Policy and X-Frame-Options, and does not publish privacy or cookie policies, which are critical for GDPR compliance. No incident response or security policy information is available. External links are configured to open in new windows with noopener for security. Overall, the website is functional, professionally designed, and provides relevant content for its audience. The main risks relate to privacy compliance gaps and missing security headers. Strategic improvements in these areas would enhance trust and regulatory adherence.

15
10
2
55
62
60
40
investmentfinanceeducationestoniainvestor+1 more
WordPressjQueryBootstrapFontAwesome+5
2025-06-25T17:07:49.772Z
itm.ee favicon

ITM Trade

itm.ee

67
TechnologyEstoniamediumMEDIUM

ITM Trade is an established IT services company based in Estonia, providing a broad range of services including programming, SEO, server and workstation administration, marketing, and e-commerce solutions. With over 15 years of experience and a portfolio of more than 300 projects across 35 countries, ITM Trade holds a strong market position as a leader in its industry. The website reflects a professional and consistent brand image targeting businesses seeking comprehensive IT solutions. The technical infrastructure of the website is modern and functional, utilizing Google Fonts, Google reCAPTCHA for form security, and slick sliders for UI elements. The site is mobile optimized and SEO friendly, though there is room for improvement in accessibility and performance optimization. Hosting and domain registration are managed by Zone Media OÜ, a reputable Estonian registrar. From a security perspective, the website employs HTTPS and reCAPTCHA, and implements a cookie consent mechanism compliant with GDPR. However, it lacks advanced security headers and a published security policy or incident response contacts. No vulnerability disclosure or security.txt file is present, which are recommended for enhanced transparency and security posture. Overall, the website is trustworthy and professionally maintained, with a good balance of content quality, technical implementation, and privacy compliance. Strategic improvements in security policies and DNS security would further strengthen its risk profile.

30
68
17
85
82
70
100
itserviceswebdevelopmentseomarketinge-commerce+1 more
Google reCAPTCHASlick SliderGoogle FontsJavaScript+1
2025-06-25T17:07:49.276Z
rescuefirst.com favicon

RESCUE®

rescuefirst.com

64
TransportationIndiasmallMEDIUM

RESCUE® is a specialized roadside assistance provider operating primarily in Bengaluru, India, offering 24/7 vehicle breakdown services including puncture repair, battery jumpstart, towing, emergency fuel delivery, and key recovery. The company positions itself as a premier and reliable service provider with OEM trained mechanics and a fleet of state-of-the-art tow trucks, servicing over 100,000 vehicles since 2011. Their business model focuses on rapid dispatch of mechanics and tow trucks within 30 minutes to customer locations, targeting vehicle owners in need of emergency roadside help. Technically, the website is built on the Webflow platform, leveraging modern web technologies such as Google Analytics, Google Tag Manager, and Google reCAPTCHA for analytics and security. The site is mobile optimized with good SEO practices and moderate performance. Accessibility is basic but functional. The hosting and infrastructure appear stable and professionally managed. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes standard security headers. Forms are protected with reCAPTCHA, and no sensitive data is exposed in the HTML. However, the site lacks a visible cookie consent mechanism and formal security or incident response policies, which are areas for improvement. No vulnerabilities or suspicious activities were detected. Overall, RESCUE® demonstrates a solid business presence with a trustworthy domain registration and consistent branding. The website quality is good, supporting the business credibility. Strategic recommendations include implementing cookie consent for privacy compliance, publishing security policies, and enhancing accessibility to further strengthen trust and compliance.

60
53
2
85
57
75
100
roadsideassistancetowingservicesvehiclebreakdownbengaluruemergencyfueldelivery+2 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAWebflow CMS+2
2025-06-25T17:07:49.238Z
gs-group.com favicon

GS Group

gs-group.com

44
TechnologyRussialargeHIGH

GS Group is a well-established Russian investment and industrial holding company with over 30 years of expertise in high-tech industries, primarily focusing on electronics development and manufacturing. The company operates a diversified portfolio including microelectronics, software development, packaging production, and energy-efficient lighting solutions. Their market position is strong within Russia, supported by a robust production base and a strategic focus on import substitution and technology localization. The website reflects a professional and consistent brand image with good content quality and clear navigation, targeting industrial partners, investors, and technology professionals. Technically, the website is built on the Bitrix CMS platform, leveraging modern JavaScript libraries and analytics tools such as Yandex Metrika and Google Tag Manager. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO. Security posture is adequate with HTTPS enforced and use of reCAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. Privacy compliance is partial; a comprehensive privacy policy is present, but no cookie consent mechanism was detected, which may pose compliance risks under GDPR. Contact information is limited to a subscription form without direct emails or phone numbers, reducing transparency. The domain WHOIS data is consistent with the business profile, showing a long-standing registration with no privacy protection, indicating legitimacy. Overall, GS Group's digital presence is professional and credible but could benefit from enhanced security practices and improved privacy compliance to strengthen trust and regulatory adherence.

20
35
2
55
67
75
20
investmentelectronicsmanufacturingtechnologyrussia+1 more
Bitrix CMSjQueryGoogle reCAPTCHAYandex Metrika+4

Partner Domains:

venture.gs
partner
technopolis.gs
partner

+3 more partners

2025-06-25T17:07:49.141Z
sisustuskoda.ee favicon

Sisustuskoda OÜ

sisustuskoda.ee

42
RetailEstoniasmallHIGH

Sisustuskoda OÜ is a small Estonian company specializing in custom-made furniture, particularly kitchen furniture for residential customers. Established in 2014, the company positions itself as a provider of quality, durable, and design-focused furniture solutions. Their website reflects a professional and consistent brand image, targeting consumers seeking bespoke interior furnishings. The business operates primarily in the retail sector with a local market focus in Estonia. Technically, the website is built on WordPress using the Astra theme and WooCommerce for e-commerce capabilities. It integrates modern tools such as Google Tag Manager and Google reCAPTCHA to enhance functionality and security. The site is mobile-optimized and demonstrates good SEO practices through structured data and meta tags. Hosting appears to be managed by Zone Media OÜ, consistent with the domain's Estonian registration. From a security perspective, the site uses HTTPS and includes reCAPTCHA to protect forms, but lacks explicit security headers and published security or incident response policies. Privacy and cookie policies are absent, posing compliance risks under GDPR. No vulnerability disclosure or security contact information is provided, which could impact trust and incident handling readiness. Overall, the website is functional and credible for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and transparent security policies to strengthen its security posture and regulatory adherence.

15
10
17
70
72
60
20
customfurniturekitchenfurnitureestoniawordpresswoocommerce+1 more
WordPressWooCommerceElementorGoogle reCAPTCHA+2
2025-06-25T17:07:48.963Z
woodman.ee favicon

Woodman

woodman.ee

41
ManufacturingEstoniamediumHIGH

Woodman is a medium-sized Estonian company specializing in the manufacturing and retail of designer furniture products. With over 16 years of professional service and sales in more than 20 countries, Woodman positions itself as a reliable and modern furniture producer collaborating with international designers. Their business model focuses on flexible production quantities and modern technologies to serve retailers and designers globally. The website reflects a professional brand image with good content quality and clear navigation, targeting furniture retailers and design professionals. Technically, the website is built on Joomla CMS and utilizes common web technologies such as jQuery, Google Analytics, Google reCAPTCHA, and bxSlider for interactive elements. The site is hosted by Radicenter OÜ, an Estonian hosting provider, and uses HTTPS with a valid SSL certificate, ensuring secure communication. Mobile optimization is good, though accessibility features are basic. SEO optimization is present but could be improved. From a security perspective, the site employs HTTPS and Google reCAPTCHA on its contact form, which are positive indicators. However, no security headers were detected, and there is no published privacy policy, cookie consent, or terms of service, which are important for GDPR compliance and user trust. No incident response or vulnerability disclosure information is available, indicating room for improvement in security transparency and readiness. Overall, the website is functional and professional but lacks critical privacy and security documentation. The domain registration is consistent with the business claims, enhancing trustworthiness. Strategic improvements in privacy compliance, security headers, and contact transparency would strengthen the site's security posture and user confidence.

20
10
2
80
72
70
-
furnituremanufacturingdesignretailestonia
jQueryGoogle AnalyticsGoogle reCAPTCHAbxSlider+3
2025-06-25T17:07:48.811Z
lab.mobi favicon

Mobi Lab OU

lab.mobi

65
TechnologyEstoniamediumMEDIUM

Mobi Lab OU is an established Estonian technology company specializing in designing and building mobile and augmented reality products. Founded in 2001, the company serves a diverse clientele including renowned tech businesses such as Microsoft, Skype, Ericsson, and Bolt. Their service offerings encompass business design, product management, digital product design, software engineering, and CTO as a Service, targeting SMEs, creative agencies, and product companies. The company positions itself as a trusted partner for innovative digital solutions with a strong market presence in the technology sector. Technically, the website is built on the Webflow CMS platform, leveraging modern web technologies including Google Tag Manager, Google Analytics, Hotjar, and Cloudflare DNS services. The site is well-optimized for performance, mobile responsiveness, and SEO, with a fast loading experience and good accessibility features. Security measures include HTTPS enforcement, Google reCAPTCHA on forms, and a cookie consent mechanism, although some security headers and DNSSEC are not implemented. From a security perspective, the website demonstrates a good posture with no critical vulnerabilities detected. However, it lacks a published privacy policy, terms of service, and explicit security or incident response policies, which are important for GDPR compliance and user trust. The domain registration data is consistent and trustworthy, with a long domain age and registrant details matching the website's business claims. Overall, Mobi Lab's website reflects a professional and credible business with strong technical infrastructure and moderate privacy compliance. Strategic improvements in privacy documentation, security headers, and DNS security would enhance their security posture and compliance standing.

60
35
2
80
72
85
100
mobileaugmentedrealitysoftwaredevelopmentuxuidesignctoasaservice+8 more
Google Tag ManagerGoogle AnalyticsHotjarCloudflare DNS+5
2025-06-25T17:07:48.739Z
ester.co favicon

Ester Digital OÜ

ester.co

53
TechnologyUnited StatesmediumMEDIUM

Ester Digital OÜ is a full-service digital agency established in 2015, providing a broad range of services including web design, branding, UI/UX software design, CMS and software development, mobile development, and IT consulting. The company targets businesses primarily in the USA, UK, Canada, and Europe, positioning itself as a trusted partner for meaningful digital growth. Their client portfolio includes notable brands such as IQVIA, T-Mobile, and NHS, indicating a strong market presence and credibility. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google reCAPTCHA, Gravity Forms, and SEO tools like Yoast. The site demonstrates good mobile optimization, SEO practices, and moderate performance. Analytics tools such as Google Analytics, Google Tag Manager, and Ahrefs are employed for user tracking and marketing insights. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks some security headers and explicit security or incident response policies. WHOIS data shows privacy protection consistent with a legitimate business, and the domain age aligns with the company's history. Privacy and cookie policies are present, though a cookie consent mechanism is missing, which is a minor compliance gap. Overall, Ester Digital presents a professional, trustworthy digital agency with solid technical infrastructure and good security hygiene, though improvements in security headers and privacy compliance mechanisms are recommended to enhance their security posture and regulatory adherence.

80
68
17
75
62
75
40
digitalagencywebdesignsoftwaredevelopmentbrandingconsulting+3 more
jQueryGoogle reCAPTCHAGravity FormsYoast SEO+3
2025-06-25T17:07:48.311Z
tark.legal favicon

Motieka & Audzevičius

tark.legal

50
OtherEstoniamediumMEDIUM

Advokaadibüroo TARK OÜ is a well-established full-service law firm based in Estonia, operating since 1991. The firm offers a broad range of legal services including corporate law, mergers and acquisitions, banking and finance, competition regulation, dispute resolution, energy, real estate, IT, labor, and tax law. Positioned as a leader in the Baltic legal market, TARK has received multiple industry recognitions and maintains a strong client testimonial presence. Their target audience primarily consists of businesses and professionals requiring comprehensive legal support in Estonia and the Baltic region. Technically, the website is built on WordPress using modern plugins such as Yoast SEO Premium and WPBakery Page Builder. It integrates multiple tracking and analytics tools including Google Analytics, Facebook Pixel, and LinkedIn Insight Tag. The site is mobile-optimized with good SEO practices, though performance is moderate. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, but lack advanced security headers and explicit security policies. The security posture is solid but could be improved by implementing additional HTTP security headers and publishing incident response and security policies. Privacy compliance is supported by a cookie consent mechanism and a privacy policy page, though terms of service and vulnerability disclosure information are absent. WHOIS data confirms domain legitimacy and consistency with the business location and history. Overall, the website reflects a professional and credible legal services provider with a mature digital presence. Strategic improvements in security policies and technical hardening would enhance trust and compliance further.

15
65
2
85
72
60
20
legallawfirmcorporatelawestoniabusinessservices+2 more
WordPressYoast SEO PremiumjQueryGoogle Analytics+4
2025-06-25T17:07:47.935Z
royal.ee favicon

eHost OÜ

royal.ee

40
OtherEstoniasmallHIGH

Aktiva.ee is an Estonian business information portal focused on supporting entrepreneurs at various stages, including startups, operating companies, and those expanding internationally. The site offers practical guidance, resources, and educational content related to business planning, management, marketing, accounting, legal frameworks, and international trade. The portal positions itself as a comprehensive guide for business success in Estonia and beyond. Technically, the website is built on WordPress, leveraging common plugins such as Google Analytics and Google reCAPTCHA for security and tracking. Hosting and DNS services are provided by eHost OÜ and Cloudflare respectively, ensuring reliable infrastructure. The site demonstrates moderate performance and good mobile optimization, with basic accessibility features. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms, but lacks explicit HTTP security headers and does not provide visible privacy or cookie policies, which are critical for GDPR compliance. No incident response or vulnerability disclosure information is available, indicating room for improvement in security transparency and readiness. Overall, the website is a well-structured, content-rich portal with moderate technical maturity and security posture. To enhance trust and compliance, it should implement comprehensive privacy and cookie policies, improve security headers, and provide clear contact and incident response information.

15
10
17
40
62
60
40
businessentrepreneurshipestoniaaccountingmarketing+1 more
WordPressjQueryGoogle reCAPTCHAGoogle Analytics+1
2025-06-25T17:07:47.918Z