Skip to main content

Real Estate security reports

Browse 3,882 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

155885
Websites
130
Industries
113
Countries
52
Avg Score
Page 64 of 78|Showing 3151-3200 of 3882
paintrite.co.nz favicon

Paintrite NZ Limited

paintrite.co.nz

55
Real EstateNew ZealandsmallMEDIUM

Paintrite NZ Limited is a small, family-operated painting service company specializing in residential and commercial painting in the Auckland and Coromandel regions of New Zealand. With over 25 years of experience, the company offers a broad range of services including interior and exterior painting, roof painting, plastering, and restoration. The website positions the company as a trusted local provider with certifications such as Dulux Accredited Painter and Ebix Trades Monitor approval, enhancing its credibility in the market. Technically, the website is built on WordPress using the Oxygen Builder framework, leveraging modern web technologies such as jQuery and Google Fonts. The site is mobile-optimized with good SEO practices and moderate performance. Hosting and domain registration are handled by reputable providers, with Cloudflare DNS in use, though DNSSEC is not enabled. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks visible security headers and formal privacy or cookie policies, indicating areas for compliance and security improvement. No forms are present on the homepage, reducing immediate data collection risks, but the absence of privacy and cookie policies may expose the company to regulatory scrutiny. Overall, the website is professional and trustworthy with a solid business presence but would benefit from enhanced privacy compliance and security hardening to align with best practices and regulatory requirements.

70
35
2
40
52
60
100
paintinghousepaintersaucklandcoromandelcommercialpainting+4 more
jQueryOxygen BuilderGoogle FontsAOS (Animate On Scroll)+1
2025-07-07T07:54:45.980Z
harrisonlane.co.nz favicon

Harrison Lane

harrisonlane.co.nz

51
Real EstateNew ZealandsmallMEDIUM

Harrison Lane is a New Zealand-based construction company specializing in luxury country homes, equestrian facilities, and rural property development primarily serving the Auckland and Waikato regions. The company emphasizes end-to-end project management, offering services from design through completion, with a focus on quality craftsmanship and award-winning builds. Their market position is that of a trusted, award-winning builder with a niche in lifestyle and equestrian construction. Technically, the website is built on the RocketSpark CMS platform and utilizes a range of modern web technologies including jQuery, Google Analytics, Facebook Pixel, and Hotjar for analytics and user behavior tracking. The site is mobile-optimized and presents a professional design with clear navigation, although accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the site uses HTTPS and includes standard tracking scripts but lacks visible security headers and explicit privacy or cookie policies, which are important for compliance and user trust. No WHOIS data was found for the domain, which raises concerns about domain registration legitimacy and transparency. No forms or email contacts were found, limiting direct communication channels. Overall, the website presents a professional and trustworthy business front but would benefit from improved transparency in privacy and security policies, enhanced security headers, and verification of domain registration details to strengthen trust and compliance.

20
35
2
55
72
55
100
constructioncountryhomesequestrianruraldevelopmentnewzealand+1 more
jQuery 1.7.2Google Analytics (gtag.js)Facebook PixelHotjar+3
2025-07-07T07:49:40.131Z
drieklomp.nl favicon

Drieklomp Makelaars en Rentmeesters

drieklomp.nl

59
Real EstateNetherlandsmediumMEDIUM

Drieklomp Makelaars en Rentmeesters is a well-established Dutch real estate brokerage firm specializing in high-end properties such as villas, landhouses, and farms. With over 35 years of experience, 6 offices, and approximately 40 employees, the company serves a discerning clientele seeking exclusive real estate services in the Netherlands. Their offerings include residential brokerage, commercial real estate, agrarian and rural properties, financial advisory, and valuation services. The website reflects a professional and consistent brand image, targeting affluent buyers and sellers in the Dutch real estate market. Technically, the site is built on WordPress with modern frameworks like Bootstrap and includes SEO optimizations and mobile responsiveness. Security posture is adequate with HTTPS and some security best practices, though improvements in security headers and explicit policies are recommended. Privacy compliance is basic with a cookie consent mechanism but lacks clear privacy and terms of service documentation. WHOIS data corroborates the legitimacy and transparency of the business with consistent registration details and domain age. Overall, the website is professional, trustworthy, and well-positioned in its market niche.

55
40
2
70
57
65
100
realestatemakelaarrentmeesternetherlandsproperty+2 more
WordPress 6.8.1Yoast SEO pluginBootstrap 5jQuery+3

Partner Domains:

drieklompfinancieel.nl
partner
2025-07-07T06:43:17.176Z
davenportslaw.co.nz favicon

Davenports Law

davenportslaw.co.nz

53
Real EstateNew ZealandmediumMEDIUM

Davenports Law is a professional law firm based in North Shore Auckland, New Zealand, specializing in Trust Law, Wills and Estate Law, Commercial Law, and Property Law. The firm targets individuals and businesses seeking tailored legal advice and ongoing support. Their website reflects a well-established regional presence with a medium-sized team and a strong focus on client collaboration and guidance. The site features detailed legal articles, team profiles, testimonials, and affiliations with reputable legal organizations, reinforcing their credibility. Technically, the website employs modern JavaScript libraries such as jQuery, Slick Carousel, and integrates Google Tag Manager, Google Analytics, Facebook Pixel, and LinkedIn Insight Tag for analytics and marketing. The site is mobile-optimized with good SEO practices and a professional design, though some accessibility features are basic. Security-wise, the site uses HTTPS and Google reCAPTCHA for form protection but lacks several recommended security headers, which could be improved to enhance defense against common web attacks. The WHOIS data for the domain is unavailable, which raises some concerns about domain registration transparency. However, the website content and professional presentation strongly suggest legitimacy. No signs of malware or phishing were detected. Privacy policy is present and comprehensive, but no cookie consent mechanism was found despite tracking technologies in use. Overall, the site presents a low risk but would benefit from enhanced security headers and clearer cookie consent to improve compliance and trust. Strategic recommendations include implementing additional security headers, establishing a cookie consent mechanism, and verifying domain registration details to improve trustworthiness and compliance.

35
53
17
80
72
70
20
lawlegaladvicetrustlawpropertylawcommerciallaw+3 more
jQueryjQuery UISlick CarouselGoogle Tag Manager+4
2025-07-07T06:41:56.569Z
kadastralekaart.com favicon

Kadastralekaart.com

kadastralekaart.com

49
Real EstateNetherlandssmallHIGH

Kadastralekaart.com operates as a specialized online platform providing free access to cadastral maps and land parcel information for the Netherlands. Founded in 2016, it serves a niche market of Dutch residents, real estate professionals, and others requiring detailed cadastral data. The website offers interactive map features, measurement tools, and downloadable cadastral data, supported by a webshop for related products. The business model combines free access with premium upgrade options, positioning itself as a trusted resource in the Dutch real estate and land information sector. Technically, the website is built on a modern Angular 20 framework, leveraging Leaflet.js for mapping functionalities and integrating WMS services for map tiles. Hosting is provided by Hetzner, a reputable provider, and the site employs Google Tag Manager for analytics with privacy-conscious settings disabling ad personalization. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms aligned with GDPR requirements. However, it lacks advanced security headers and does not publish explicit security policies or incident response contacts. No vulnerabilities or suspicious activities were detected, and the domain registration is consistent with the business profile, enhancing trustworthiness. Overall, Kadastralekaart.com presents a professional, secure, and privacy-conscious online service with a clear focus on cadastral data for the Netherlands. Strategic improvements in security policy transparency and enhanced security headers could further strengthen its posture and user trust.

30
68
2
60
65
65
20
cadastralmapnetherlandsrealestatelandparcel+3 more
Angular 20Leaflet.jsGoogle Tag ManagerWMS map services+1
2025-07-07T06:41:21.499Z
awatoruproperty.co.nz favicon

Awatoru Property

awatoruproperty.co.nz

40
Real EstateNew ZealandsmallHIGH

Awatoru Property is a New Zealand-based commercial and industrial property investment partnership combining the expertise of 3Group and the capital strength of a major institutional investor. The company focuses on developing, funding, managing, and owning high-quality commercial and industrial properties primarily in the Auckland region and surrounding areas. Their business model emphasizes long-term property holding with stable leases and sustainable building practices. The website reflects a professional and consistent brand image, targeting investors and commercial tenants. Technically, the website is built on WordPress 6.8.1, utilizing modern frontend technologies such as Bootstrap 4.6.1, jQuery, Owl Carousel, and Google reCAPTCHA v3 for form security. The site is mobile optimized and SEO friendly with proper meta tags and structured data. Hosting details are not explicit but the domain registrar is a reputable provider. Performance is moderate with no major technical issues detected. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA to protect its contact form from spam. However, it lacks important security headers and does not provide a security policy or incident response contact. No vulnerabilities or exposed sensitive data were found. Privacy compliance is weak due to the absence of privacy and cookie policies, which is a notable gap given GDPR and other regulations. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security best practices. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements in privacy disclosures and security headers would strengthen the site's security posture and regulatory compliance.

15
35
2
60
72
40
20
realestatepropertyinvestmentcommercialpropertyindustrialpropertynewzealand
Bootstrap 4.6.1jQuery 3.2.1Google reCAPTCHA v3Owl Carousel+2

Partner Domains:

3group.co.nz
partner
thebrandery.co.nz
partner
2025-07-07T06:40:46.443Z
b3buildings.co.nz favicon

C3 Construction

b3buildings.co.nz

44
Real EstateNew ZealandmediumHIGH

B3 Buildings is a New Zealand-based construction company specializing in commercial fit outs, building refurbishment, and maintenance services. As part of the larger 3Group property business, B3 Buildings leverages strong financial backing and integrated services to deliver high-quality projects primarily targeting property managers and owners. Their business model focuses on creating long-term value through reliable and efficient building services. The website reflects a medium-sized enterprise with a professional and consistent brand presence, supported by certifications such as Telarc and Toitu. Technically, the website is built on WordPress 6.8.1 with modern frameworks including Bootstrap 5.3.3, jQuery, and Owl Carousel. SEO is well-implemented using Yoast SEO, and the site is mobile-optimized with good user experience. Hosting and domain registration are consistent with the business location and timeline. Performance is moderate, with room for improvement in accessibility features. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks important security headers and a cookie consent mechanism, which impacts privacy compliance. No visible security or incident response policies are published, which could be a concern for compliance and trust. No vulnerabilities or exposed sensitive data were detected in the content. Overall, the website is trustworthy and professional, with a solid business foundation and good technical implementation. However, improvements in privacy compliance, security headers, and incident response transparency are recommended to enhance security posture and regulatory adherence.

15
53
17
55
52
80
-
constructionbuildingservicesrealestatecommercialfitoutsrefurbishment+1 more
jQuery 3.2.1Bootstrap 5.3.3Owl CarouselAOS (Animate on Scroll)+2

Partner Domains:

3group.co.nz
partner
c3construction.co.nz
partner

+3 more partners

2025-07-07T06:40:31.415Z
biv.be favicon

Beroepsinstituut van Vastgoedmakelaars

biv.be

65
Real EstateBelgiummediumMEDIUM

The Beroepsinstituut van Vastgoedmakelaars (BIV) is the official professional institute and regulatory body for real estate brokers in Belgium. It focuses on ensuring integrity, professionalism, and compliance within the real estate sector by providing certification, training, complaint handling, and knowledge dissemination. The website serves as a comprehensive resource for brokers, trainees, and the public, offering detailed information on becoming a broker, ethical guidelines, and complaint procedures. The organization maintains a strong market position as the authoritative entity overseeing real estate professionals in Belgium. Technically, the website is built on Drupal 10, leveraging modern web technologies and integrating Google Tag Manager and Cookiebot for analytics and privacy compliance. The site is well-optimized for mobile devices, accessible, and SEO-friendly, with a professional design and clear navigation. Privacy and cookie policies are prominently available, demonstrating good compliance with GDPR requirements. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms. However, no advanced security headers or explicit security policies were detected, and no vulnerability disclosure or incident response contacts are published. The WHOIS data for the domain is restricted, limiting transparency about domain ownership, which slightly impacts trust but is common for .be domains. Overall, the website presents a professional, trustworthy, and well-maintained digital presence for the BIV, with minor recommendations to enhance security posture and transparency to further strengthen trust and compliance.

55
83
2
65
52
80
100
realestateregulatoryprofessionalinstitutebelgiumbiv+5 more
Drupal 10Google Tag ManagerCookiebotjQuery UI Autocomplete

Partner Domains:

ipi.be
partner
2025-07-07T05:33:52.322Z
hirschlerlaw.com favicon

Hirschler Fleischer

hirschlerlaw.com

64
Real EstateUnited StatesmediumMEDIUM

Hirschler Fleischer is a professional law firm based in Virginia, providing a broad range of legal services with a focus on client success and complex legal issues. The firm positions itself as a national-caliber entity with a strong emphasis on partner involvement and business efficiency. Their website reflects a medium-sized firm with consistent branding and professional content aimed at business and individual clients seeking legal counsel. Technically, the website employs modern web standards including HTTPS, Google Tag Manager for analytics, and responsive design elements. While the site performs moderately well and offers good accessibility and SEO features, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site benefits from HTTPS and secure form practices but lacks visible security headers and a formal vulnerability disclosure policy. The absence of WHOIS data raises questions about domain registration legitimacy, although the professional presentation and external references support the firm's credibility. Overall, the site is safe, trustworthy, and suitable for general audiences. Strategically, the firm should address privacy compliance gaps, enhance security headers, and clarify domain registration details to strengthen trust and security posture.

40
53
17
70
72
80
100
lawfirmlegalservicesvirginiaprofessionalservicesbusinesslaw+1 more
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:33:17.250Z
move.nl favicon

Realworks B.V.

move.nl

57
Real EstateNetherlandsmediumMEDIUM

Move.nl is a Dutch website operated by Realworks B.V., providing an online client dossier platform for real estate professionals. The company is well-established, with a domain registered since 1996, indicating a mature presence in the real estate software market in the Netherlands. The website branding and business focus align with the registrant information, supporting legitimacy. However, the website content is minimal, primarily showing a loading screen with no visible privacy, cookie, or terms of service policies, and no contact information is present in the provided HTML content. Technically, the website uses modern JavaScript frameworks such as React and Ant Design icons, indicating a contemporary tech stack. Mobile optimization and accessibility are basic but present. Performance is moderate based on the loading scripts and styles. However, there is a lack of security headers and no Content-Security-Policy, which are important for protecting users and the site from common web vulnerabilities. From a security perspective, the site has DNSSEC enabled and uses HTTPS (implied by the domain and scripts), but the absence of security headers and privacy-related policies reduces its security posture. No vulnerability disclosure or incident response information is publicly available. No analytics or advertising scripts were detected, suggesting minimal user tracking. The overall risk is moderate due to missing security best practices and compliance documentation. Strategically, the site should improve transparency by publishing privacy and cookie policies, implementing security headers, and providing clear contact information. These steps will enhance trust and compliance with GDPR and other regulations. The technical stack is modern but could benefit from performance and accessibility improvements. Overall, the site is legitimate but requires enhancements to security and privacy to meet professional standards fully.

65
25
2
70
72
70
100
realestatesoftwareclientdossiernetherlandssaas
ReactJavaScriptAnt Design Icons
2025-07-07T04:23:42.479Z
dathuis.nl favicon

DatHuis

dathuis.nl

58
Real EstateNetherlandssmallMEDIUM

DatHuis is a Dutch company specializing in marketing products and lead generation platforms tailored for real estate professionals. The website positions itself as an all-in-one solution for lead generation and cross-selling within the real estate sector, targeting professionals in the Netherlands. The business model is B2B, focusing on providing digital marketing tools and services to enhance client acquisition and retention for real estate agents and related professionals. The company was founded in 2016, consistent with the domain registration date, and operates with a small-sized business profile. Technically, the website is built on WordPress with a modern tech stack including HubSpot marketing tools, Cookiebot for cookie consent, Chargebee for payment processing, and Intercom for customer engagement. The site is well-optimized for SEO with Yoast SEO plugin and includes structured data for enhanced search engine understanding. Performance is moderate with good mobile optimization and basic accessibility features. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks DNSSEC and explicit security headers. Cookie consent is properly implemented, indicating awareness of privacy compliance, although no explicit privacy policy or terms of service pages were detected in the provided content. No direct contact or incident response information is available, which could be improved to enhance trust and compliance. Overall, the website presents a professional and trustworthy front for its target audience, with strong marketing and analytics integration. Recommendations include enabling DNSSEC, adding security headers, publishing privacy and security policies, and providing clear contact information for security and business inquiries to strengthen compliance and security posture.

55
83
2
70
90
65
20
realestatemarketingleadgenerationdutchwordpress+4 more
WordPress 6.8.1Yoast SEO pluginjQuery 3.7.1Cookiebot+6
2025-07-07T04:23:27.386Z
nvm.nl favicon

Nederlandse Coöperatieve Vereniging van Makelaars en Taxateurs in onroerende goederen NVM U.A.

nvm.nl

61
Real EstateNetherlandslargeMEDIUM

The Nederlandse Coöperatieve Vereniging van Makelaars en Taxateurs in onroerende goederen NVM U.A. (NVM) is a well-established cooperative association representing over 5500 real estate professionals in the Netherlands. Founded in 1898 and headquartered in Utrecht, it holds a leading position in the Dutch real estate sector, providing membership services, industry representation, and market data. The website reflects this professional stature with clear branding and relevant content targeting both industry members and consumers. Technically, the website employs modern digital tools including Google Tag Manager, Google Analytics, Cookiebot for cookie consent management, and LinkedIn Insight tags. The site is served over HTTPS with appropriate security headers, indicating a strong security posture. Performance and mobile optimization are good, though accessibility could be improved. The cookie consent mechanism is comprehensive and GDPR compliant, reflecting a mature privacy approach. Security-wise, the site demonstrates good practices such as HTTPS enforcement and security headers but lacks publicly available security policies or incident response contacts. No vulnerabilities or suspicious patterns were detected. The WHOIS data aligns well with the business identity, confirming legitimacy and trustworthiness. Overall, the website is professional, secure, and compliant with privacy regulations, serving its audience effectively. Strategic improvements could focus on publishing explicit security policies and enhancing accessibility to further strengthen trust and compliance.

15
88
2
80
72
50
100
realestatecooperativenetherlandsmakelaarstaxateurs+3 more
Google Tag ManagerGoogle AnalyticsCookiebotLinkedIn Insight Tag+1
2025-07-07T04:23:22.363Z
svr-architects.eu favicon

SVR-ARCHITECTS

svr-architects.eu

67
Real EstateBelgiumsmallMEDIUM

SVR-ARCHITECTS is a professional architectural firm based in Belgium specializing in healthcare, research, housing, utility buildings, and interior design. The company targets clients seeking specialized architectural services with a focus on living, work, and well-being environments. Their website reflects a well-structured and professional presence with clear navigation and relevant content showcasing their key services and projects. Technically, the website is built on WordPress using the Divi theme and several plugins including SEO and cookie consent tools, indicating a moderate level of digital maturity. Security posture is adequate with HTTPS enforced and cookie consent implemented; however, the absence of security headers and vulnerability disclosure mechanisms suggests room for improvement. Overall, the website is trustworthy and professional, though it lacks some compliance documentation such as a privacy policy and terms of service pages. The domain WHOIS data is privacy protected, which is common and acceptable for this business type, but limits detailed domain age and registrant verification. Strategic recommendations include enhancing security headers, publishing privacy and security policies, and adding vulnerability disclosure information to improve trust and compliance.

30
83
17
80
62
85
100
architecturehealthcarerealestateinteriordesignconstruction+1 more
WordPress 6.8.1Divi Theme 4.27.4jQuery 3.7.1All in One SEO Pro 4.8.4.1+3
2025-07-07T03:14:46.903Z
lammersmakelaars.nl favicon

Lammers NVM Makelaars

lammersmakelaars.nl

46
Real EstateNetherlandssmallHIGH

Lammers NVM Makelaars is a well-established real estate agency based in Zoetermeer, Netherlands, operating since 1998. The company specializes in residential property sales, purchases, and valuations, focusing on local expertise and personalized service. Their market position is strong within the local community, supported by high customer ratings on platforms like Funda and membership in the NVM professional association. The website reflects a professional business model targeting homeowners and buyers in the Zoetermeer area. Technically, the website uses a modern but somewhat dated tech stack including Bootstrap 3 and jQuery, with integrations for Google Tag Manager and marketing platforms. The site is mobile responsive at a basic level and SEO optimized with proper meta tags and structured navigation. Security posture is good with HTTPS enforced and no visible sensitive data exposure, but lacks advanced security headers and explicit incident response or security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, the site is trustworthy and professional, with room for improvement in security and privacy transparency.

25
40
2
70
72
60
20
realestatemakelaarzoetermeernvmwoning+3 more
jQueryBootstrap 3.3.4Font AwesomeGoogle Tag Manager+2

Partner Domains:

waarderapport.lammersmakelaars.nl
partner
www.nvm.nl
partner

+2 more partners

2025-07-07T02:08:56.608Z