Skip to main content

Real Estate security reports

Browse 3,882 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

155885
Websites
130
Industries
113
Countries
52
Avg Score
Page 5 of 78|Showing 201-250 of 3882
merlinestates.com favicon

Merlin Estates Ltd

merlinestates.com

46
Real EstateUnited KingdomsmallHIGH

Merlin Estates Ltd is a UK-based family-run residential property management company specializing in the administration and maintenance of private residential estates. The company offers a range of services including property management, maintenance, financial management, company secretary services, development site visits, and property insurance. Positioned as a cost-effective and professional service provider, Merlin Estates targets developers and residential property owners seeking reliable estate management solutions. The website content is clear and focused on their core business, with contact information and service details prominently displayed. Technically, the website employs standard web technologies including Google Analytics for visitor tracking, Pinterest scripts, and Google Maps API for location services. The site is accessible and functional but shows basic mobile optimization and limited accessibility features. There is no detected CMS or advanced frameworks, indicating a simple custom-built or static site. Performance is moderate with no major issues detected. From a security perspective, the site lacks visible security headers and does not provide privacy or cookie policies, which are critical for GDPR compliance and user trust. The WHOIS data for the domain is missing, raising concerns about domain registration legitimacy and ownership transparency. No forms or email addresses are present for direct contact, limiting user engagement options. Overall, the security posture is basic and requires improvements to meet modern standards. The overall risk assessment suggests the business is legitimate but would benefit from enhanced transparency, security best practices, and privacy compliance measures. Strategic recommendations include implementing HTTPS with strong SSL, publishing privacy and cookie policies, adding security headers, and clarifying domain registration details to improve trust and compliance.

85
47
40
70
35
15
17
propertymanagementresidentialservicesrealestateukestatemanagement
Google AnalyticsPinterest JSGoogle Maps API
2026-07-07T07:15:54.982Z
spaltd.co.uk favicon

SPA Ltd

spaltd.co.uk

51
Real EstateUnited KingdommediumMEDIUM

SPA Ltd is a well-established commercial property maintenance company operating primarily in London, Greater London, South East England, South Yorkshire, and the Midlands. With over 20 years of experience, the company offers a broad range of services including mechanical and electrical works, property maintenance, plumbing, roofing, and more. Their market position is supported by a quality client list and a focus on health and safety, ethical business practices, and investment in technology. The website reflects a professional business model targeting commercial property owners and managers in the UK regions served. Technically, the website is built on WordPress with Fusion Builder and integrates HubSpot for cookie consent and analytics. The site is mobile-optimized and has good SEO and accessibility basics. Security posture is solid with HTTPS and no visible vulnerabilities, though there is room for improvement in security headers and vulnerability disclosure. Privacy compliance is basic with a privacy policy available but no terms of service or security policy pages. Overall, the website is professional, trustworthy, and credible with clear contact information and partner links.

65
64
20
85
2
25
68
mechanicalelectricalpropertymaintenancelondonsoutheastenglandsouthyorkshire+1 more
WordPress 6.9.4jQuery 3.7.1FontAwesome 6.9.4Fusion Builder+1

Partner Domains:

thecarchargerinstallers.co.uk
partner
thesolarenergyinstallers.co.uk
partner
2026-07-07T07:12:10.834Z
shellardtiles.co.uk favicon

Hubert Shellard & Sons Ltd t/a Shellard Tiles

shellardtiles.co.uk

54
Real EstateUnited KingdomsmallMEDIUM

Shellard Tiles is a well-established tile retailer based in Lisburn, Northern Ireland, specializing in designer floor and wall tiles for residential and commercial customers. The company operates a showroom and offers a wide range of tile products sourced from leading European manufacturers. Their website reflects a professional business with clear contact information, customer testimonials, and relevant policies, supporting their market position as a trusted local supplier. Technically, the website is built on WordPress with common plugins such as Yoast SEO and Contact Form 7. It uses standard web technologies including jQuery and Google Analytics for tracking. While the site is functional and moderately optimized for performance and SEO, it uses outdated software versions and lacks advanced security headers, which could expose it to vulnerabilities. From a security perspective, the site employs HTTPS and does not expose sensitive data in its HTML. However, the absence of security headers, outdated CMS and libraries, and lack of visible incident response or security policies indicate room for improvement. Privacy compliance is partial, with policies present but no active cookie consent mechanism. Overall, the website is credible and safe for general users but would benefit from technical and security updates to enhance protection and compliance. Strategic improvements in security posture and privacy practices are recommended to maintain trust and reduce risk.

70
70
20
60
-
17
68
tilesflooringwalltilesshowroomlisburn+4 more
jQuery 2.1.3Google AnalyticsMasterSliderFlexSlider+2

Partner Domains:

icon-creative.com
partner
2026-07-07T07:11:43.726Z
readdunnconnell.co.uk favicon

Read Dunn Connell Limited

readdunnconnell.co.uk

45
Real EstateUnited KingdomsmallHIGH

Read Dunn Connell Limited operates RDC Solicitors, a small UK-based law firm specializing in property, family law, wills, trusts, tax and probate, dispute resolution, and employment law. The firm targets individuals and businesses primarily in North and West Yorkshire, with offices in Bradford, Ilkley, and Bingley. The website presents a professional image with clear service offerings and client testimonials, positioning the firm as a trusted regional legal service provider. Technically, the website uses modern web technologies including jQuery and Google Tag Manager, with responsive design and good SEO practices. However, some security best practices such as security headers and cookie consent mechanisms are missing or not detected, representing areas for improvement. The WHOIS data is unavailable due to domain naming rules violation, which slightly impacts trust but does not negate the legitimacy indicated by company registration details and professional presentation. Security posture is moderate with HTTPS usage implied but lacking explicit security headers and formal security policies. No forms are present on the homepage, reducing attack surface but also limiting direct data collection. Overall, the site is safe, professional, and trustworthy with room to enhance privacy compliance and security hardening. Strategic recommendations include implementing cookie consent for GDPR compliance, adding security headers, publishing security and incident response policies, and regular audits of third-party scripts to maintain a strong security posture.

57
-
55
65
50
2
53
solicitorslawwillstruststax+10 more
jQuery 3.5.1Google Tag ManagerBootstrap CarouselHTML5+1
2026-07-07T07:10:22.186Z
B

Bruce Gillingham Pollard

brucegillinghampollard.com

48
Real EstateUnited KingdommediumHIGH

Bruce Gillingham Pollard is a specialized real estate consultancy focused on providing creative property solutions to prestigious property owners, developers, retailers, and restauranteurs primarily in the UK. The company has a strong market position with over 20 years of experience, offering services such as retail and leisure leasing, investment advisory, lease consultancy, and tenant mix curation. Their website showcases a comprehensive portfolio of projects and client engagements, reflecting a mature and professional business model. Technically, the website is built on WordPress with modern JavaScript libraries like jQuery and integrates Google Analytics and Google Tag Manager for tracking. The site is well-structured, mobile-optimized, and demonstrates good SEO and accessibility practices. However, some security headers are missing, and no cookie consent mechanism is present, which could be improved to enhance privacy compliance. From a security perspective, the site uses HTTPS with a good SSL configuration and anonymizes IP addresses in analytics, indicating attention to user privacy. The absence of explicit security headers and incident response information suggests room for improvement in security posture. The WHOIS data is missing or unavailable, which raises concerns about domain registration legitimacy, although the website content and business information appear consistent and professional. Overall, the website presents a credible and professional business with a solid digital presence but would benefit from enhanced security headers, explicit cookie consent, and verification of domain registration details to strengthen trust and compliance.

70
20
47
80
17
53
15
realestatepropertyconsultancyleasinginvestmentretail+4 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager
2026-07-07T07:09:44.107Z
richardjames.net favicon

Richard James Estate Agents

richardjames.net

48
Real EstateUnited KingdommediumHIGH

Richard James Estate Agents operates as a professional real estate agency with multiple offices in Wellingborough, Irthlingborough, and Rushden, UK. The company offers a broad range of services including residential sales, lettings, property management, land and new homes, and mortgage services. Affiliated with the Relocation Agent Network, it leverages national connections to enhance its local market presence. The website reflects a medium-sized business with consistent branding and strong trust indicators such as industry certifications and customer reviews. Technically, the website employs a modern technology stack including Bootstrap, jQuery, and Google services for analytics and maps. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Privacy and cookie policies are implemented with GDPR compliance, and reCAPTCHA is used to mitigate bot activity. However, the absence of explicit security headers and incomplete WHOIS data represent areas for improvement. From a security perspective, the site uses HTTPS and has basic security practices in place but lacks visible advanced security headers. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is missing or unavailable, which raises questions about domain registration legitimacy, though the business information on the site is credible and well-documented. Overall, the website is professional, trustworthy, and functional with moderate technical and security maturity. Strategic improvements in security headers, WHOIS transparency, and accessibility could enhance its posture and trustworthiness further.

57
70
20
75
20
65
2
realestateestateagentspropertysaleslettingspropertymanagement+3 more
jQueryBootstrapSlick CarouselSelectric+5
2026-07-07T07:08:27.580Z
F

Franklyn Nevard Associates Ltd

franklynnevard.co.uk

62
Real EstateUnited KingdomsmallMEDIUM

Franklyn Nevard Associates Ltd is a small, well-established architectural firm based in the UK, with over 40 years of experience providing residential and commercial architectural services primarily in Ealing and Suffolk. The company offers a broad range of services including dimensional surveys, layout designs, building regulation approvals, and interior design. The website reflects a professional and consistent brand image with clear contact information and company registration details, supporting its credibility in the market. Technically, the website is built on the itseeze platform, uses Google Fonts, and integrates Google Analytics and Tag Manager with privacy-conscious consent settings. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security posture is generally good with HTTPS enforced and cookie consent implemented; however, the absence of security headers and incident response information suggests room for improvement. The WHOIS data is unavailable due to domain registration issues, which raises concerns about domain legitimacy despite the professional website content. Overall, the site is safe, trustworthy, and suitable for general audiences seeking architectural services.

70
100
54
60
68
60
2
architectureresidentialealingarchitecturalservicesuk+1 more
Google AnalyticsGoogle Tag ManagerGoogle FontsCustom JavaScript+1
2026-07-07T07:03:29.130Z
edinburghsashwindows.co.uk favicon

Illingworth Brothers

edinburghsashwindows.co.uk

53
Real EstateUnited KingdomsmallMEDIUM

Illingworth Brothers is a small, family-run business specializing in the manufacture and installation of traditional sash and case windows, wooden doors, and UPVC windows and doors primarily serving Edinburgh and the surrounding Lothian area. The company emphasizes quality craftsmanship with over 60 years of experience and offers a range of products designed to meet conservation and energy efficiency standards. The website reflects a professional and consistent brand image with clear contact information and customer testimonials, positioning the company as a trusted local specialist in home improvement products. Technically, the website employs common web technologies including jQuery, Google Analytics, Google reCAPTCHA for form security, and media players for enhanced user experience. The site is moderately optimized for mobile devices and SEO, with a clear navigation structure and relevant meta tags. However, there is no evidence of a CMS or advanced frameworks, and performance is moderate. Security measures include HTTPS and reCAPTCHA, but the absence of explicit security headers and detailed security policies indicates room for improvement. From a security perspective, the site shows moderate maturity with basic protections in place but lacks comprehensive security headers and incident response information. The WHOIS data is unavailable due to domain naming errors, which raises concerns about domain registration consistency and trustworthiness. No critical vulnerabilities or malware indicators were found, but the site would benefit from enhanced security practices and transparency. Overall, the website is functional, professional, and trustworthy for its business purpose but should address domain registration inconsistencies and strengthen security posture to improve trust and compliance.

32
65
70
100
15
68
2
sashwindowsupvcwindowswoodendoorsdoubleglazingedinburgh+1 more
jQueryGoogle AnalyticsGoogle reCAPTCHAjPlayer+1
2026-07-06T07:23:24.050Z
msl-ltd.co.uk favicon

MSL Property Care Services Ltd

msl-ltd.co.uk

66
Real EstateUnited KingdommediumMEDIUM

MSL Property Care Services Ltd is a UK-wide property maintenance and facilities management company established in 2008. They provide a comprehensive range of services including reactive repairs, planned maintenance, statutory compliance, and project works, supported by a dedicated in-house team and an accredited SafePartner network. Their market position is strong, serving leading UK brands across multiple sectors such as retail, healthcare, education, and property management. The company emphasizes trust, reliability, and sustainability in managing national estates. Technically, the website is built on modern web technologies including Webflow CMS, Cloudflare CDN, and integrates analytics tools like Google Analytics and Microsoft Clarity. The site is well-optimized for performance, mobile responsiveness, and SEO, with a professional design and clear navigation. Cookie consent and privacy compliance are robustly implemented using Cookiebot. From a security perspective, the site benefits from HTTPS, DNSSEC, and Cloudflare protections. While no critical vulnerabilities were detected, the absence of some HTTP security headers and a public security policy page suggests room for improvement. The WHOIS data confirms a long-established domain with consistent registration details, enhancing trustworthiness. Overall, MSL's digital presence reflects a mature, credible business with strong compliance and security postures. Strategic recommendations include enhancing HTTP security headers, publishing a security policy, and adding a vulnerability disclosure mechanism to further strengthen trust and transparency.

30
83
37
70
47
70
100
propertymaintenancefacilitiesmanagementukcertificationscompliance+5 more
CloudflareCookiebotGoogle Tag ManagerMicrosoft Clarity+5
2026-07-06T07:19:19.639Z
Z

ZFA Group

zfagroup.com

43
Real EstateUnited KingdommediumHIGH

ZFA Group is a modern property management company operating primarily in London and Dublin, offering services such as guaranteed rent, free maintenance, tenant sourcing, and hospitality management. The company positions itself as a trusted and fast-growing player in the residential asset management sector, managing over 1,300 properties valued at approximately £500 million. Their website reflects a professional business with clear service offerings and customer testimonials, targeting landlords and tenants seeking reliable property management solutions. Technically, the website employs a modern front-end stack including jQuery, Bootstrap, Google Analytics, and Google Tag Manager, with asynchronous script loading to optimize performance. The site is mobile responsive and SEO optimized, though accessibility features are basic. The absence of a CMS or hosting provider information limits deeper infrastructure insights. Performance is moderate, with room for improvement in accessibility and security headers. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks visible security headers such as Content-Security-Policy or X-Frame-Options. No vulnerabilities or exposed sensitive data were detected in the HTML content. However, the absence of privacy and cookie policies and no incident response contact details indicate gaps in compliance and security transparency. The WHOIS data is missing, which raises concerns about domain registration legitimacy despite the professional website presence. Overall, the website is functional and professional but would benefit from enhanced security practices, privacy compliance, and domain registration transparency to improve trustworthiness and reduce risk exposure.

57
20
65
70
20
2
35
propertymanagementrealestatelondonguaranteedrenthospitality
jQueryBootstrapGoogle AnalyticsGoogle Tag Manager+3
2026-07-06T07:12:41.988Z
M

Mackenzie Jones

macjones.com

63
Real EstateUnited KingdomsmallMEDIUM

Mackenzie Jones is a well-established law firm operating primarily in Cheshire and North Wales, with offices in Chester, St Asaph, and Menai Bridge. The firm offers a broad range of legal services including personal injury, conveyancing, family law, wills and probate, clinical negligence, and various business legal services. Their market position is that of a trusted regional legal provider with over two decades of history and a client base built on recommendations and repeat business. Technically, the website is built on the Umbraco CMS platform and integrates modern tools such as Google Analytics, Google Tag Manager, LiveChat, and Cookiebot for consent management. The site is mobile-optimized and provides a good user experience with clear navigation and professional design. Security-wise, the site enforces HTTPS and uses reCAPTCHA for form protection, but could improve by adding more comprehensive security headers. Privacy compliance is well addressed with a clear privacy policy and cookie consent mechanism. The absence of WHOIS data is a notable anomaly but does not detract significantly from the overall trustworthiness given the professional presentation and trust indicators. Overall, the website presents a secure, compliant, and professional digital presence for the law firm.

57
80
85
100
2
83
15
legalsolicitorslawfirmconveyancingpersonalinjury+3 more
Google AnalyticsGoogle Tag ManagerLiveChatCookiebot+4

Partner Domains:

rapidpay.co.uk
partner
reviewsolicitors.co.uk
partner

+1 more partners

2026-07-06T07:11:12.738Z
todd-milburn.co.uk favicon

Todd Milburn Partnership Limited

todd-milburn.co.uk

43
Real EstateUnited KingdommediumHIGH

Todd Milburn Partnership Limited is a well-established UK-based consultancy specializing in property and construction services, including project management, quantity surveying, employer’s agent roles, and principal designer services. With over 30 years of experience, the company positions itself as a trusted independent specialist serving both public and private sector clients. The website reflects a professional and consistent brand image, supported by recognized industry certifications such as RICS and APS. Contact information is clearly provided, enhancing business credibility. Technically, the website is built on WordPress with modern plugins like Yoast SEO and Slider Revolution, hosted by 20i Ltd. The site is mobile-optimized and performs moderately well, with good SEO practices evident. Security posture is solid with HTTPS enforced and no exposed sensitive data, though it lacks advanced security headers and published security policies. Privacy compliance is a notable gap, with no visible privacy or cookie policies, which should be addressed to meet GDPR requirements. Overall, the security posture is good but could be improved by implementing security headers, publishing incident response and vulnerability disclosure information, and enhancing privacy compliance. The site is free from adult or questionable content, targeting a general professional audience. The domain registration is consistent with the business claims, showing a long-standing presence and legitimacy. Strategic recommendations include enhancing privacy and cookie policies, adding security and incident response documentation, and improving accessibility features to further strengthen trust and compliance.

57
65
20
55
15
17
35
constructionpropertyconsultancyprojectmanagementquantitysurveying+4 more
WordPressYoast SEO pluginSlider RevolutionjQuery+1
2026-07-06T07:00:26.495Z
designpomegranate.com favicon

Design Pomegranate

designpomegranate.com

57
Real EstateUnited KingdomsmallMEDIUM

Design Pomegranate is a small architectural studio based in Islington, London, specializing in bespoke residential architecture. Their website presents a professional image with a focus on quality and delivery of beautiful living spaces. The company targets clients seeking personalized architectural services for residential projects. The site is built on the Squarespace platform, leveraging modern web technologies such as Typekit fonts and JSON-LD structured data for SEO and semantic clarity. While the technical infrastructure is adequate with moderate performance and good mobile optimization, there is room for improvement in accessibility and SEO practices. From a security perspective, the website lacks visible security headers and privacy-related policies, which are important for compliance and user trust. The absence of WHOIS data raises concerns about domain registration legitimacy, although the website content and contact information suggest a legitimate business operation. No signs of adult or questionable content were detected, making the site safe for general audiences. Overall, the website demonstrates a solid business presence with professional design and clear contact information but requires enhancements in security posture and privacy compliance to strengthen trust and regulatory adherence. Verification of domain registration status is recommended to ensure legitimacy and reduce risk.

75
100
70
54
17
35
35
architectureresidentialdesignlondonsquarespace
SquarespaceTypekit fontsYUI JavaScript libraryJSON-LD structured data
2026-07-05T07:25:12.880Z
crcnorth.com favicon

CRC North Ltd

crcnorth.com

48
Real EstateUnited KingdomsmallHIGH

CRC North Ltd is a small, family-owned UK-based firm of Chartered Surveyors established in 1987, specializing in property development, project management, and investment services within the Greater Manchester, Merseyside, and Cheshire regions. The company positions itself as an experienced regional player with a focus on maximizing land and property asset potential through professional expertise and commercial acumen. The website reflects this business focus with clear service descriptions and a professional design, although it lacks comprehensive contact details and policy disclosures. Technically, the website employs common frontend technologies such as jQuery, Bootstrap, and UIkit, with a CMS indicated as MYOB. The site is moderately optimized for mobile and performance but lacks advanced SEO and accessibility features. No analytics or tracking scripts were detected, indicating minimal user tracking. Security-wise, the domain is well-registered with appropriate domain status locks, but the website lacks DNSSEC, security headers, and visible HTTPS enforcement details, which lowers its security posture. The security posture is moderate with no critical vulnerabilities detected in the visible content, but improvements are needed in security headers, DNSSEC, and privacy compliance. The absence of privacy and cookie policies and contact information for incident response reduces compliance and trustworthiness. Overall, the website is safe, professional, and suitable for general audiences, but it could benefit from enhanced security and compliance measures. Strategically, CRC North should prioritize publishing privacy and cookie policies, implementing DNSSEC, adding security headers, and providing clear contact information to improve trust and compliance. These steps will strengthen their security posture and align with GDPR and industry best practices.

-
69
85
75
2
50
35
realestatepropertydevelopmentprojectmanagementinvestmentcharteredsurveyors+1 more
jQueryBootstrapUIkitWidgetkit
2026-07-05T07:20:58.557Z
umh.com favicon

UMH Properties | Manufactured Home Sales & Rentals in Land-Lease Communities

umh.com

75
Real EstateUnited StateslargeMEDIUM

UMH Properties operates as a well-established real estate business specializing in manufactured home sales and rentals within land-lease communities primarily in the Northeastern United States. With a history dating back to 1968 and a domain registered since 1995, the company presents itself as a large regional player offering affordable housing solutions with competitive financing and a broad portfolio of over 106 communities and 19,000 homes. The website reflects a professional digital presence with good content quality, clear branding, and consistent messaging aligned with its business model. Technically, the website is built on WordPress and leverages modern web technologies including Yoast SEO for optimization, Google Maps API for location services, and CookieYes for cookie consent management. Accessibility tools such as User1st are implemented, enhancing usability for diverse users. Performance is moderate with good mobile optimization and SEO practices, though some improvements in security headers and DNSSEC could enhance the technical posture. From a security perspective, the site enforces HTTPS and employs domain transfer protection, but lacks DNSSEC and explicit security headers in the provided data. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with cookie consent mechanisms present but no explicit privacy policy or terms of service pages found in the analyzed content. Contact information is not explicitly available in the provided HTML snippet, which could impact user trust and compliance. Overall, UMH Properties demonstrates a solid business and technical foundation with room for improvement in privacy disclosures and security hardening. Strategic recommendations include publishing comprehensive privacy and security policies, enabling DNSSEC, and adding security headers to strengthen trust and compliance.

75
62
80
100
88
25
85
manufacturedhomesrealestatehomesalesland-leasecommunitiesaffordablehousing+2 more
WordPressYoast SEO pluginjQueryGoogle Maps API+3
2026-07-05T07:10:19.329Z
cullimoredutton.co.uk favicon

Cullimore Dutton Solicitors Limited

cullimoredutton.co.uk

56
Real EstateUnited KingdommediumMEDIUM

Cullimore Dutton Solicitors Limited is a well-established legal and financial advisory firm based in Cheshire, UK, with a heritage dating back to 1792. The company offers a broad range of services including family law, property conveyancing, estate planning, and independent financial advice, targeting individuals, families, and business owners in the Cheshire and Chester region. The firm positions itself as a trusted local advisor providing joined-up legal and financial services under one roof, emphasizing clarity, respect, and professionalism. Technically, the website is built on WordPress and leverages modern web technologies such as jQuery, Yoast SEO for search optimization, Contact Form 7 for user inquiries, and Google reCAPTCHA for spam protection. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate, with room for improvement in security headers and some external tracking domains. From a security perspective, the website enforces HTTPS and uses reCAPTCHA on forms, indicating a good baseline security posture. However, there is no explicit evidence of advanced security headers or a published security policy or incident response plan. The WHOIS lookup for the domain failed due to a naming rules error, but the domain is active and professionally maintained, suggesting legitimacy despite incomplete WHOIS data. Overall, the website is professional, trustworthy, and compliant with privacy regulations, including GDPR. The main risks relate to incomplete WHOIS data and minor security header omissions. Strategic improvements in security policy transparency and header implementation would enhance the security posture and trustworthiness further.

70
80
57
40
83
17
15
legalsolicitorscheshirefinancialadvicefamilylaw+3 more
jQueryYoast SEOContact Form 7Google reCAPTCHA+1
2026-07-04T07:18:31.729Z
rjevansroofing.com favicon

RJ Evans Flat Roofing Limited

rjevansroofing.com

52
Real EstateUnited KingdommediumMEDIUM

RJ Evans Flat Roofing Limited is a UK-based commercial roofing contractor specializing in engineered roofing systems for commercial and industrial buildings nationwide. The company offers a comprehensive range of services including installation, repair, inspection, and maintenance of flat and low-slope roofing systems tailored to meet UK regulatory and environmental demands. Their market position is strong, supported by multiple industry accreditations and positive customer testimonials, targeting commercial property owners and facilities managers across the UK. Technically, the website employs modern web technologies such as Google Analytics, Bootstrap, and hCaptcha, indicating a moderate to advanced digital maturity. The site is well-structured, mobile-optimized, and SEO-friendly, though some improvements in accessibility and security headers could enhance its technical posture. From a security perspective, the site benefits from HTTPS and form protection via hCaptcha, alongside cookie consent mechanisms supporting GDPR compliance. However, the absence of visible security headers and lack of explicit incident response or security policy pages suggest areas for improvement. The missing WHOIS data introduces some uncertainty regarding domain registration legitimacy, though the website content and trust signals mitigate this concern. Overall, RJ Evans presents a professional and trustworthy online presence with solid business credibility and technical implementation. Strategic enhancements in security practices and domain registration transparency would further strengthen their security posture and trustworthiness.

57
60
-
85
68
40
25
commercialroofingflatroofingroofingcontractorwaterproofingukroofing+2 more
Google AnalyticsGoogle Tag ManagerhCaptchajQuery+3
2026-07-04T07:17:54.656Z
P

Prestige Roofing Ltd

prestige-roofing.co.uk

35
Real EstateUnited KingdomsmallHIGH

Prestige Roofing Ltd is a well-established roofing company based in London, providing residential and commercial roofing services including new roof installations, re-roofing, emergency repairs, and cladding installation. The company has over 40 years of experience and holds reputable certifications such as Which? Trusted Trader and membership in the Guild of Master Craftsmen, positioning it as a trusted service provider in its market segment. The website reflects a professional business with clear service offerings and customer testimonials supporting its credibility. Technically, the website is built on WordPress with a modern tech stack including popular plugins for analytics, forms, and sliders. It uses HTTPS and has moderate performance and good mobile optimization. However, some security best practices such as security headers and cookie consent mechanisms are missing, which could be improved to enhance compliance and security posture. Security-wise, the site shows no immediate vulnerabilities or exposed sensitive data, but the absence of security headers and incident response information indicates room for improvement. The WHOIS data is unavailable due to domain naming rules errors, which limits domain trust verification, but the website content and certifications provide compensating trust signals. Overall, the website is professional and trustworthy with moderate technical maturity and a good security baseline. Strategic improvements in privacy compliance and security hardening are recommended to further strengthen the company's digital presence and trustworthiness.

40
60
-
52
15
2
35
roofingconstructionservicesuktrustedtrader+2 more
WordPress 5.7.15PHPjQuery 3.5.1Revolution Slider 5.4.1+5
2026-07-04T07:12:49.391Z
M

Mainstream Plumbing & Heating Ltd

mainstreamplumbing.co.uk

48
Real EstateUnited KingdomsmallHIGH

Mainstream Plumbing & Heating Ltd is a small UK-based company specializing in plumbing and heating services primarily for new build construction projects. The company has over twenty years of experience and serves regions including Yorkshire & Humberside, East Anglia, and The Midlands. Their client base includes notable developers such as Barratts, Lindens, Bovis, and Morris Homes. The website content is straightforward, providing a basic overview of their services and company values, but lacks detailed contact information and compliance documentation. Technically, the website is built using RapidWeaver CMS and incorporates older JavaScript libraries such as jQuery 1.11.0 and Modernizr. The site shows basic mobile optimization and accessibility but lacks modern security features such as HTTPS enforcement and security headers. There is no evidence of analytics or tracking tools, and no privacy or cookie policies are present, indicating low digital maturity. From a security perspective, the absence of HTTPS and security headers, combined with the failure to retrieve WHOIS data due to domain registration errors, raises concerns about the domain's legitimacy and security posture. No forms or data collection mechanisms are present, reducing exposure to input-based vulnerabilities but also limiting user engagement. The website does not demonstrate GDPR compliance or incident response readiness. Overall, while the business appears legitimate and established based on website content, the technical and security shortcomings, especially the domain registration issues, present risks. Strategic improvements in security, compliance, and digital presence are recommended to enhance trust and operational resilience.

55
65
100
54
25
35
2
plumbingheatingnewbuildsconstructionlincoln+1 more
jQuery 1.11.0Modernizr
2026-07-04T07:07:59.380Z
S

Spencer Birch

spencerbirch.co.uk

52
Real EstateUnited KingdomsmallMEDIUM

Spencer Birch is a small, independent firm of chartered surveyors and estate agents based in Nottingham, UK, with a history dating back to 1984. The company offers residential and commercial surveying, estate agency services, and property lettings, positioning itself as a leading local player with a focus on practical advice and competitive fees. The website reflects this business focus with relevant content and clear contact information but lacks modern privacy and security features. Technically, the website is built on Joomla CMS using older technologies such as MooTools and jQuery, with a dated Artisteer template. The site shows moderate performance and basic mobile optimization but lacks advanced SEO and accessibility features. Integration with external property listing platforms like Rightmove is evident through embedded forms. From a security perspective, the site uses email obfuscation to reduce spam but lacks visible security headers and explicit HTTPS confirmation in the provided data. No privacy or cookie policies are present, and WHOIS data for the domain is unavailable due to an invalid domain query, which reduces trustworthiness. Overall, the security posture is moderate but could be improved significantly. The overall risk is moderate with no critical vulnerabilities detected in the content. Strategic improvements in security headers, privacy compliance, and WHOIS domain registration transparency are recommended to enhance trust and compliance.

60
70
100
47
20
10
50
realestateestateagentspropertysurveyorsnottingham+3 more
jQueryMooToolsJoomla CMSArtisteer template
2026-07-04T07:03:04.556Z
stoford.com favicon

Stoford

stoford.com

62
Real EstateUnited KingdommediumMEDIUM

Stoford is a UK-based property development company specializing in occupier led development and strategic land promotion within the commercial real estate sector. The website presents a professional image with clear business descriptions, targeting landowners, occupiers, and investors. The company positions itself as a leading player in the UK commercial property market, offering bespoke design and build solutions and managing a portfolio of developments. The site includes social media integration and uses modern web technologies such as Foundation CSS, jQuery, and Google Analytics, indicating a moderate level of digital maturity. From a security perspective, the website enforces HTTPS and employs Google reCAPTCHA v2 on its contact forms, which helps mitigate spam and automated abuse. However, the absence of key security headers and explicit security or incident response policies suggests room for improvement in security posture. The cookie consent mechanism and privacy policy indicate basic GDPR compliance, but no terms of service or vulnerability disclosure policies were found. The WHOIS data is notably absent, with no registrar, creation date, or registrant information available from the VeriSign database. This inconsistency reduces the domain's trustworthiness despite the professional website content. There are no signs of WAF or content blocking, and no suspicious or malicious content was detected. Overall, the site is safe and professional but would benefit from enhanced transparency and security documentation. Strategic recommendations include implementing security headers, publishing comprehensive security and incident response policies, improving contact information transparency, and addressing the WHOIS data gap to enhance trust and compliance.

80
47
100
65
45
83
2
realestatepropertydevelopmentukbusinesscommercialpropertystrategicland+1 more
Foundation CSSjQuerySlick CarouselLeaflet.js+2
2026-07-03T07:28:42.263Z
T

Terrenus Land & Water Ltd

terrenus.co.uk

46
Real EstateUnited KingdomsmallHIGH

Terrenus Land & Water Ltd is a small, specialized consultancy focused on land development risk reduction and cost management primarily in Scotland and the UK. The company positions itself as an approachable and expert partner for land developers, emphasizing timely and budget-conscious solutions. The website reflects this professional positioning with clear business descriptions, contact information, and relevant policy documents. Technically, the website employs modern web technologies including HTTPS, Google Analytics, Google Tag Manager, and reCAPTCHA, indicating a moderate level of digital maturity. However, the absence of explicit privacy and terms of service pages suggests room for improvement in compliance and transparency. Security posture is generally good with HTTPS and reCAPTCHA in place, but lack of visible security headers and incident response contacts are notable gaps. The WHOIS data for the domain 'www.terrenus.co.uk' is unavailable due to a domain registration error, which raises concerns about domain legitimacy, though the website content itself appears credible and professional. Overall, the site is safe, well-structured, and trustworthy from a content perspective but would benefit from enhanced compliance documentation and security hardening.

69
60
70
20
35
35
2
consultancylanddevelopmentukscotlandenvironment+1 more
Google AnalyticsGoogle Tag ManagerreCAPTCHAMooTools JavaScript library+2
2026-07-03T07:21:13.124Z
lansdownegreen.co.uk favicon

Lansdowne Green Ltd

lansdownegreen.co.uk

58
Real EstateUnited KingdomsmallMEDIUM

Lansdowne Green Ltd is a UK-based company specializing in the supply and erection of Structural Insulated Panels (SIPs) for innovative and sustainable home and extension construction. The company positions itself as an expert in SIPs, targeting homeowners, architects, and builders interested in efficient and environmentally friendly building solutions. The website reflects a small-sized business with a professional online presence, including industry certification and client testimonials that enhance trust. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Google Fonts and Vimeo for multimedia content. The site is moderately performant, mobile-optimized, and includes basic accessibility features. SEO practices are adequately implemented with proper meta tags and structured data. From a security perspective, the site enforces HTTPS with HSTS, indicating good SSL configuration. However, it lacks several recommended security headers and does not provide privacy or cookie policies, which are critical for compliance and user trust. The absence of WHOIS data due to domain naming rules limits transparency but does not necessarily indicate illegitimacy. Overall, Lansdowne Green Ltd presents a credible and professional business with room for improvement in privacy compliance and security best practices. Strategic enhancements in these areas will strengthen the company's digital trustworthiness and regulatory adherence.

60
54
70
100
17
50
35
constructionsipssustainablebuildingrealestateuk
Squarespace CMSVimeo video embedGoogle Fonts (Work Sans)Squarespace JavaScript libraries
2026-07-03T07:20:17.127Z
commercial-properties-scotland.co.uk favicon

James Keiller Property Holdings Ltd

commercial-properties-scotland.co.uk

58
Real EstateUnited KingdommediumMEDIUM

James Keiller Property Holdings Ltd is a privately owned property development, investment, and management company based in Dundee, Scotland, established in 1981. The company focuses on residential and commercial property projects across Scotland, with a strong presence in Tayside and the central belt. Their services include land sourcing, planning, project management, construction, acquisition, and disposal, targeting landowners, financial institutions, and local authorities. The website presents a professional image with clear contact details and partner affiliations but lacks key compliance documents such as privacy and cookie policies. Technically, the site is built on WordPress with Elementor and uses Google Analytics and Tag Manager for tracking. Security posture is adequate with HTTPS enabled and secure forms, but missing security headers and absence of incident response or security policies reduce maturity. The WHOIS data is missing or unavailable, which raises concerns about domain legitimacy despite the professional website content. Overall, the site is functional and business-appropriate but would benefit from improved transparency and security practices.

72
65
100
70
35
2
45
propertydevelopmentrealestateinvestmentcommercialpropertyresidentialproperty+2 more
WordPressElementorjQueryGoogle Tag Manager+1

Partner Domains:

zoopla.co.uk
partner
lettingweb.com
partner
2026-07-03T07:07:15.142Z
prestonengsurv.co.uk favicon

PRESTON ENGINEERING SURVEY LTD

prestonengsurv.co.uk

54
Real EstateUnited KingdomsmallMEDIUM

PRESTON ENGINEERING SURVEY LTD is a small, professional surveying company based near Launceston on the Cornwall-Devon border, offering a wide range of surveying and geomatics services including land surveys, measured building surveys, laser scanning, and construction site setting out. The company targets architects, engineers, designers, and construction professionals primarily in the South West of England. Their website reflects a well-established business with over 20 years of experience, supported by clear service descriptions and social media presence. Technically, the website is built on the Create.net CMS platform, utilizing modern JavaScript libraries such as jQuery and Google Analytics for tracking. The site is mobile-optimized with good navigation and SEO practices, though accessibility features are basic. Performance is moderate, and HTTPS is properly implemented, ensuring secure connections. From a security perspective, the site lacks several important security headers and does not provide a privacy policy or cookie consent mechanism, which are critical for GDPR compliance. No incident response or security policy information is available. The WHOIS lookup failed due to an invalid query on the subdomain, resulting in missing domain registration data and reducing trustworthiness. However, the website content and contact information support the legitimacy of the business. Overall, the website presents a professional and trustworthy business but should improve privacy compliance and security headers to enhance user trust and regulatory adherence.

60
40
100
49
2
35
70
surveyinglandsurveymeasuredbuildingsurveylaserscanningconstruction+3 more
jQuery 3.7.1jQuery Migrate 3.5.2Google Analytics (gtag.js)AOS (Animate On Scroll)+3
2026-07-03T07:01:21.877Z
C

CloudNine Creative Interiors

descabusinessfurniture.co.uk

59
Real EstateUnited KingdomsmallMEDIUM

CloudNine Creative Interiors is a UK-based bespoke interior design and furniture manufacturing company specializing in high-quality office and residential furniture. The company emphasizes craftsmanship with over 70 years of combined experience and holds accreditations for specialized materials such as Corian and Krion. Their market position is that of a niche provider catering to both corporate and private clients, offering full design consultancy and installation services. The website reflects a professional and consistent brand image with clear contact details and customer testimonials, enhancing trustworthiness. Technically, the website is built on the itseeze CMS platform and employs modern web technologies including Google Analytics and Tag Manager for minimal user tracking. The site is mobile-optimized with responsive design scripts and good SEO practices. Performance is moderate, and accessibility is basic but functional. Security posture is solid with HTTPS enforced and cookie consent implemented, though security headers and advanced policies are lacking. The security evaluation reveals no critical vulnerabilities or exposed sensitive data. However, the absence of security headers and a formal incident response or vulnerability disclosure policy are areas for improvement. Privacy compliance is adequate with clear privacy and cookie policies and GDPR consent mechanisms in place. WHOIS data could not be extracted due to a query error on the 'www' subdomain, but the domain appears legitimate and consistent with the business branding. Overall, the website presents a low-risk profile with good business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing a security policy, and improving accessibility to further strengthen the security posture and compliance framework.

60
70
37
100
60
2
68
interiordesignbespokefurnitureofficefurniturecommercialinteriorsresidentialinteriors+2 more
Google AnalyticsGoogle Tag ManagerCustom JavaScriptResponsive design scripts
2026-07-02T07:27:08.145Z