Skip to main content

Other security reports

Browse 25,797 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

148819
Websites
130
Industries
113
Countries
52
Avg Score
Page 71 of 516|Showing 3501-3550 of 25797
np-recht.de favicon

Rechtsanwaltskanzlei Nolte › ‹ Pustejovsky

np-recht.de

44
OtherGermanysmallHIGH

Rechtsanwaltskanzlei Nolte › ‹ Pustejovsky is a specialized law firm based in Freiburg, Germany, offering expert legal services in areas such as corporate law, labor law, inheritance law including business succession, family law, data protection, IT law, and intellectual property law. The firm targets both companies and private individuals, positioning itself as a boutique legal service provider with a strong focus on specialized legal fields. Their website reflects a professional and consistent brand image with comprehensive service descriptions and regular legal updates via their blog and social media channels. Technically, the website is built on WordPress with modern SEO and caching plugins, ensuring moderate performance and good mobile optimization. The hosting is managed via kasserver.com, and the site uses HTTPS with a good SSL configuration. However, some security best practices such as security headers and incident response disclosures are missing, which could be improved to enhance the security posture. From a security perspective, the site shows no signs of vulnerabilities or exposed sensitive data. The absence of a cookie consent mechanism and security headers are minor gaps in GDPR compliance and security hardening. The WHOIS data aligns well with the website content, showing consistent domain registration and no privacy protection, which supports the legitimacy of the business. Overall, the website is trustworthy, professionally maintained, and suitable for its target audience. Strategic improvements in privacy compliance and security policies would further strengthen its position and user trust.

15
33
2
85
72
60
-
lawlegalserviceslawfirmgermanyprivacy+3 more
WordPress 6.7.4Yoast SEO plugin v26.2jQuery 3.7.1WP Rocket 3.17.3.1+4
2025-10-23T02:59:58.636Z
D

503 Service Temporarily Unavailable

digivalmedia.es

35
OtherN/asmallHIGH

The website www.digivalmedia.es is currently inaccessible, returning a 503 Service Temporarily Unavailable error indicating server maintenance or capacity issues. Due to this, no business content, metadata, or contact information is available for analysis. The WHOIS data is also inaccessible because the registrar restricts WHOIS queries to authorized IP addresses only, preventing extraction of domain registration details. This limits the ability to verify domain legitimacy or business credentials. Technically, the site lacks any detectable technologies, scripts, or frameworks due to minimal HTML content. There is no evidence of HTTPS enforcement, security headers, or privacy and cookie policies. The site is not optimized for mobile or SEO, and no analytics or tracking tools are present. The overall technical maturity and digital infrastructure cannot be assessed beyond the fact that the site is currently down. From a security perspective, the lack of accessible content and headers prevents a thorough evaluation. The site does not expose any sensitive data or forms, but the unavailability itself is a critical issue impacting user trust and business continuity. The absence of privacy and security policies further reduces compliance posture. WHOIS data restrictions add uncertainty to domain legitimacy. Overall, the site scores very low on content quality, technical implementation, security posture, privacy compliance, and business credibility. The primary risk is operational downtime and lack of transparency. Strategic recommendations include restoring site availability, publishing privacy and security policies, enabling HTTPS and security headers, and improving WHOIS data accessibility to enhance trust.

-
15
2
65
72
85
20
2025-10-23T01:51:35.046Z
sugardaddy.date favicon

Maiatsaco Ltd

sugardaddy.date

56
OtherCyprusmediumMEDIUM

SugarDaddy.date is an established online dating platform specializing in sugar daddy and sugar baby matchmaking, primarily targeting mature adults in Germany and surrounding regions. The business operates under Maiatsaco Ltd, a Cyprus-registered company, and positions itself as Germany’s leading sugar daddy dating agency. The platform offers membership registration for both men and women, emphasizing a safe, discreet, and luxurious dating experience. The website is professionally designed with multilingual support and clear calls to action, reflecting a mature and focused business model in the adult dating sector. Technically, the website is built on WordPress using Elementor and Yoast SEO plugins, supported by Cloudflare for DNS and CDN services. It employs modern web technologies including Google Tag Manager and Google reCAPTCHA for security and analytics. The site demonstrates good mobile optimization and SEO practices, though performance is moderate. Security posture is solid with HTTPS enforced and domain transfer protections in place, but could benefit from enhanced HTTP security headers and DNSSEC activation. From a security and compliance perspective, the site provides comprehensive privacy, cookie, and terms of service policies, indicating GDPR awareness and user data protection. However, no explicit incident response or vulnerability disclosure policies were found. The content is adult-oriented, focusing on sugar dating, which requires mature audience targeting and appropriate disclaimers. No critical vulnerabilities or suspicious activities were detected, and the domain WHOIS data aligns well with the business claims, supporting legitimacy. Overall, SugarDaddy.date presents a credible and professionally managed online dating service with a good balance of business maturity, technical infrastructure, and security awareness. Strategic improvements in security headers, incident response transparency, and DNSSEC could further enhance trust and resilience.

50
73
2
55
72
75
40
datingsugardaddysugarbabyonlinedatingmembership+3 more
WordPressElementorYoast SEOGoogle reCAPTCHA+2
2025-10-23T01:22:20.882Z
N

ne16.com

ne16.com

60
OtherN/asmallMEDIUM

The website at app.ne16.com/Analytics/Home is a minimal login portal likely serving as an internal or customer-facing analytics application. The site uses modern frontend technologies such as React and integrates third-party services like Appcues and Segment for user experience and analytics tracking. However, the site lacks publicly accessible business information, privacy policies, cookie consent mechanisms, and contact details, limiting transparency and trust. The absence of WHOIS data for the subdomain further complicates legitimacy verification, suggesting this is a private or internal application rather than a public-facing commercial website. Technically, the site employs modern JavaScript frameworks and asynchronous loading of scripts, indicating a contemporary tech stack. Performance and mobile optimization appear basic but functional. Security posture is weak due to missing HTTPS confirmation, lack of security headers, and no visible security or privacy policies. The login form collects email and password but no visible security measures like CAPTCHA or multi-factor authentication are evident. Overall, the security posture is minimal with significant gaps in privacy compliance and transparency. The lack of WHOIS data and business information reduces trustworthiness. There are no indications of malicious content or adult material, but the site’s limited content and lack of policies suggest it is not intended for broad public use. Strategic improvements in security headers, HTTPS enforcement, privacy disclosures, and contact information are recommended to enhance trust and compliance. The risk assessment indicates a low to moderate risk primarily due to limited transparency and security best practices. The site is suitable for authenticated users but should improve compliance and security to meet enterprise standards.

65
50
2
70
77
75
100
loginanalyticsappreactsecurity
ReactAppcuesSegment
2025-10-23T01:18:45.207Z
myzco.com favicon

MYZ Bilgisayar Otomotiv İnşaat Petrol Sanayi Tic. Ltd. Şti.

myzco.com

63
OtherTurkeymediumMEDIUM

MYZ Bilgisayar Otomotiv İnşaat Petrol Sanayi Tic. Ltd. Şti. is a diversified Turkish company established in 2014, offering a wide range of services including open-air advertising, media and advertising, IT and software development, automotive and fleet rental, consultancy, logistics, supply, and commodity trading. The company targets business clients seeking comprehensive solutions across these sectors and maintains a moderate market position with a medium-sized enterprise profile. Their website reflects a professional and consistent brand image with clear service descriptions and client references. Technically, the website employs modern front-end technologies such as Bootstrap and jQuery, with Cloudflare DNS services. The site is moderately optimized for performance and mobile use, though accessibility and SEO features are basic. No CMS or advanced analytics tools are detected, indicating a relatively straightforward technical infrastructure. From a security perspective, the site uses HTTPS and has domain transfer protections in place, but lacks DNSSEC and important security headers, which are recommended for enhanced protection. No explicit security or incident response policies are published, and no vulnerability disclosure or data protection officer information is available. Cookie consent is implemented with an opt-in mechanism, and a privacy policy is present but basic. Overall, the website is safe, professional, and trustworthy with no adult or questionable content. The domain registration data aligns well with the business history, supporting legitimacy. Strategic improvements in security headers, DNSSEC, and published security policies would enhance the security posture and compliance standing.

35
50
2
85
75
85
100
advertisingmediatechnologylogisticsautomotive+2 more
BootstrapjQueryfullPage.jsCloudflare DNS
2025-10-23T00:13:00.553Z
krolstudio.com favicon

Krolstudio

krolstudio.com

38
OtherSwitzerlandsmallHIGH

Krolstudio is a small, Geneva-based design and communication agency specializing in graphic design, web design, photography, video, and event communication services. The company emphasizes high-quality visual identity creation and a multidisciplinary approach to meet client needs. The website reflects a professional business with clear service offerings and contact information, targeting businesses and individuals seeking creative design solutions. Technically, the website is built on WordPress with common plugins such as Yoast SEO, and uses jQuery and tracking tools like Google Analytics and Facebook Pixel. Hosting is provided by Infomaniak Network SA, a reputable Swiss hosting provider. The site is moderately optimized for performance and mobile, though SEO is limited by a noindex,nofollow robots meta tag. From a security perspective, the site uses HTTPS and has domain transfer protection, but lacks DNSSEC and security headers. There is no visible privacy or cookie policy, which is a compliance gap. Tracking scripts indicate moderate user tracking without explicit consent mechanisms. Overall, the security posture is average with room for improvement. The website content is safe for general audiences, with no adult or questionable content detected. The domain registration is consistent with the business age and location, supporting legitimacy. Strategic recommendations include adding privacy and cookie policies, enabling DNSSEC, implementing security headers, and improving SEO settings to enhance visibility and compliance.

25
35
17
70
-
60
20
designgraphicdesignwebdesignphotographyvideo+5 more
WordPressYoast SEO pluginjQueryGoogle Analytics+2
2025-10-23T00:09:50.097Z
gbh-news.at favicon

Gewerkschaft Bau-Holz

gbh-news.at

10
OtherAustrialargeCRITICAL

The website www.gbh-news.at serves as an information platform for members of the Gewerkschaft Bau-Holz (GBH), a trade union representing workers in the construction and wood industries in Austria. It provides news, member services, legal support, education, and campaign information, positioning itself as a key resource for approximately 250,000 employees across multiple sectors. The site is well-branded, professionally designed, and targets union members and stakeholders in the Austrian construction and wood sectors. Technically, the website employs standard web technologies including HTML5, CSS, JavaScript, and jQuery, with integrations such as Matomo for analytics and Usercentrics for consent management, reflecting a moderate level of digital maturity. The site is mobile-optimized and includes CAPTCHA protections on forms to mitigate spam. However, no CMS or hosting provider details are evident, and some security headers appear to be missing. From a security perspective, the site enforces HTTPS and uses consent management to comply with GDPR. While no critical vulnerabilities or exposed sensitive data were detected, the absence of explicit security policies, incident response contacts, and a security.txt file suggests room for improvement in transparency and readiness. The lack of WHOIS data reduces trust in domain registration legitimacy, though the website content and branding appear consistent and professional. Overall, the site presents a low-risk profile with good privacy compliance and user experience but would benefit from enhanced security disclosures and WHOIS transparency to strengthen trust and compliance posture.

-
-
-
-
-
-
-
gbhgewerkschaftbau-holztradeunionaustriaconstruction+5 more
HTML5CSSJavaScriptjQuery+3
2025-10-23T00:07:32.929Z
uglsc.it favicon

UGL Sicurezza Civile

uglsc.it

10
OtherItalysmallCRITICAL

UGL Sicurezza Civile is a labor union organization focused on protecting the rights and promoting the safety of workers in the civil security sector in Italy. Founded recently in 2023, it operates primarily as a non-profit entity providing advocacy, training, and informational resources to its members. The website serves as a communication platform featuring news, articles, and updates relevant to its target audience of security workers and union members. The organization maintains an active social media presence and offers newsletter subscriptions to keep stakeholders informed. Technically, the website is built on WordPress using the Elementor page builder, supported by a CDN for content delivery. It employs modern web technologies including jQuery and LiteSpeed caching for performance optimization. The site is mobile-optimized and features good SEO practices, although accessibility features are basic. Privacy and cookie policies are clearly presented, indicating compliance with GDPR requirements. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks DNSSEC and advanced security headers, which are recommended for enhanced protection. No critical vulnerabilities or exposed sensitive data were detected. The domain registration is consistent with the business claims, transparent, and legitimate. Overall, the website presents a professional and trustworthy front for the organization. The overall risk assessment is moderate with no critical issues detected. Strategic recommendations include enabling DNSSEC, implementing additional security headers, and publishing explicit security and incident response policies to further strengthen trust and compliance.

-
-
-
-
-
-
-
laborunionsecuritycivilsecurityitaliannews+4 more
WordPressElementorjQueryPHP+1

Partner Domains:

enbisit.it
partner
2025-10-23T00:07:12.822Z
I

ITAS Mutua

itasnow.it

60
OtherItalylargeMEDIUM

ITASnow.it is a dedicated website offering mandatory ski insurance in Italy, operated by ITAS Mutua, a well-established insurance mutual company. The site targets skiers in Italy, providing an easy and immediate online purchase experience for the required ski insurance. The business model focuses on direct online sales of insurance policies, leveraging ITAS Mutua's brand and market presence. The domain registration and DNSSEC status support the legitimacy of the business, with a domain age consistent with the product launch timeline. Technically, the website employs modern web technologies including React, Google Tag Manager, OneTrust for cookie consent, and Worldline Italy's payment SDK for secure transactions. Accessibility is enhanced via the AccessiWay tool. The site demonstrates good mobile optimization, SEO practices, and a strict Content Security Policy, contributing to a robust technical infrastructure and digital maturity. From a security perspective, the website benefits from HTTPS, DNSSEC, and a strict CSP. However, the use of an outdated jQuery version and the absence of explicit privacy policy and terms of service pages are notable gaps. No security.txt or vulnerability disclosure information is present, and no direct contact information for security incidents is provided. Cookie consent mechanisms are implemented comprehensively, supporting GDPR compliance. Overall, the website presents a professional and trustworthy front for its insurance product, with strong technical and security foundations. To enhance compliance and trust, publishing clear privacy and terms documents, updating legacy libraries, and providing direct contact channels for security and customer support are recommended.

40
40
2
45
100
70
100
insuranceskiinsuranceitalyonlinepurchasemandatoryinsurance+1 more
React (implied by root div and JS bundle naming)jQuery 1.12.4AxeptaSDKClient (Worldline payment SDK)Google Tag Manager+2

Partner Domains:

pay.worldlineitalia.it
partner
payment.worldlineitalia.it
partner

+2 more partners

2025-10-22T23:12:33.780Z
vmvgmbh.com favicon

VMV GmbH

vmvgmbh.com

10
OtherGermanysmallCRITICAL

VMV GmbH is a specialized event management company focused on organizing and marketing Volksfeste, markets, and related events primarily in the Ulm region of Germany. With nearly two decades of experience, the company positions itself as a trusted partner for municipalities and event organizers, offering comprehensive services from concept development to execution and marketing. The website reflects a professional and consistent brand image, emphasizing their expertise and long-standing event references. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Cookiebot for GDPR-compliant cookie management. Hosting is provided by Hetzner Online GmbH, a reputable German hosting provider. The site is mobile-optimized and performs moderately well, with room for improvement in accessibility and security headers. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. Cookie consent is implemented thoroughly, reflecting good privacy compliance. However, the site lacks explicit security policies or incident response contacts, which could enhance trust further. Overall, VMV GmbH presents a credible and professional online presence with strong compliance and a clear business focus. Strategic improvements in security headers and incident response transparency are recommended to further strengthen their security posture and trustworthiness.

-
-
-
-
-
-
-
eventmanagementvolksfestemarketsfestivalorganizationcookieconsent+3 more
WordPress 6.8.3jQuery 3.7.1Bootstrap CSSCookiebot for cookie consent+1
2025-10-22T23:09:59.183Z