Skip to main content

Latvia security reports

Browse 12,807 Guard analyses across this slice of the directory — NIS2 / GDPR readiness, SSL/TLS, DNS hygiene and email authentication.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 42 of 257|Showing 2051-2100 of 12807
puskupusku.lv favicon

Slowdown

puskupusku.lv

0
RetailLatviasmallHIGH

Slowdown is a specialized e-commerce retailer focused on bean bags, poufs, and related furniture products, primarily serving the Latvian market with a broader European presence through sister sites. The company offers a variety of seating solutions including indoor and outdoor bean bags, chairs, sofas, and accessories, emphasizing handmade quality and European manufacturing. The website is professionally designed with clear navigation, multiple product categories, and a strong brand identity. Contact information and social media presence are well established, supporting customer engagement and trust. Technically, the website employs modern web technologies including JavaScript, CSS, and integrates marketing and analytics tools such as Google Tag Manager, Facebook Pixel, Omnisend, and Tawk.to chat. The site uses HTTPS and cookie consent mechanisms, indicating a good level of privacy compliance. However, some security headers are missing, and no explicit security policy or incident response information is provided. From a security perspective, the site demonstrates a solid posture with encrypted connections and no visible vulnerabilities or exposed sensitive data. The lack of WHOIS data due to query limits suggests domain privacy protection, which is common and justified for retail businesses. Overall, the risk profile is low, but improvements in security headers and vulnerability disclosure practices are recommended. Strategically, Slowdown should focus on enhancing security best practices, maintaining GDPR compliance, and expanding transparency around data protection and incident response. The website quality and business credibility are strong, supporting continued growth in their niche market.

-
10
17
55
-
80
-
beanbagsfurnituree-commercelatviaretail+4 more
JavaScriptCSSHTML5Google Tag Manager+4

Partner Domains:

slowdown.cc
sister
baggus.com
sister

+3 more partners

2025-07-30T16:00:48.424Z
e-komercija.lv favicon

eComStrive

e-komercija.lv

0
TechnologyLatviasmallMEDIUM

eComStrive is a Latvian digital agency specializing in web development and SEO marketing services, targeting businesses seeking to improve their online presence and e-commerce performance. The company offers a comprehensive range of services including website creation, e-shop development, SEO optimization, technical SEO audits, SEO content creation, and data analytics. Their website demonstrates a strong market position supported by client testimonials and measurable success stories, indicating effective service delivery and customer satisfaction. Technically, the website is built on WordPress with WooCommerce integration, leveraging modern technologies such as WP Rocket for performance optimization, Google Fonts, and various marketing and analytics tools including Google Tag Manager, Hotjar, and Pipedrive LeadBooster. The site is well-optimized for SEO and mobile responsiveness, providing a fast and accessible user experience. From a security perspective, the site uses HTTPS and includes security best practices such as CAPTCHA on contact forms and performance/security plugins. However, explicit security policies and incident response information are not publicly available, and the WHOIS data is inaccessible due to query limits, though no suspicious indicators are present. Privacy and cookie policies are comprehensive and GDPR compliant, reflecting a good privacy posture. Overall, eComStrive presents a professional, trustworthy, and technically sound digital presence with a strong focus on client success and compliance. Strategic recommendations include enhancing security transparency, implementing a security.txt file, and maintaining up-to-date software to further strengthen their security posture.

65
10
17
60
-
80
100
seowebdevelopmente-commercedigitalagencymarketing+2 more
WordPressWooCommercejQueryGoogle Fonts+5
2025-07-30T16:00:48.292Z
C

CASUS SIA

cazus.lv

0
OtherLatviasmallMEDIUM

CASUS SIA operates as a legal and detective services firm based in Latvia, offering a broad range of legal services including commercial law, labor law, consumer rights, criminal law, detective services, real estate transactions, civil law, insolvency, and migration law. The company targets both legal entities and private individuals, providing services such as consultations, document preparation, representation in courts and government institutions, and detective investigations. The website presents a professional image with detailed service descriptions and transparent pricing, positioning CASUS as a trusted local provider in its niche. Technically, the website is built using the Hugo static site generator, leveraging Google Fonts and Google Tag Manager for analytics and marketing. The site is mobile-optimized with good navigation and content structure. However, there is a lack of explicit privacy and cookie policies, and no visible security headers, which are areas for improvement. The WHOIS data could not be retrieved due to query limits, but the website content and company registration details support legitimacy. Security posture is moderate; HTTPS is implied but no security headers were detected in the provided data. The site uses external scripts for analytics and form handling but lacks visible anti-spam or CSRF protections on forms. Privacy compliance is weak due to missing policies and consent mechanisms. Overall, the site is professional and trustworthy but would benefit from enhanced security and privacy measures. The overall risk is low given the nature of the business and the professional presentation, but improvements in privacy compliance and security best practices are recommended to strengthen trust and regulatory adherence.

30
10
17
85
72
80
100
legaldetectivelatvialawconsulting+1 more
Hugo 0.58.2Google Fonts (Montserrat)Google Tag ManagerFormspree (form handling)
2025-07-30T16:00:48.244Z
latviaeuropeanresidency.com favicon

S-Baltic LV

latviaeuropeanresidency.com

0
Real EstateLatviamediumCRITICAL

S-Baltic LV operates a professional website focused on providing residence and citizenship by investment services, primarily for Latvia and the broader European Union. The company is positioned as a global leader in this niche, founded by an experienced immigration specialist, Mr. Gerald Hoppstaedter. Their services include immigration legal support, visa applications, document legalization, real estate advice, and company establishment. The website reflects a medium-sized business with a clear target audience of international investors and entrepreneurs seeking residency solutions in Europe. Technically, the website is built on WordPress with popular plugins such as WooCommerce and Elementor, indicating a modern and flexible infrastructure. Hosting appears to be managed via GoDaddy, with standard technologies like jQuery and Slider Revolution enhancing user experience. The site is mobile-optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No privacy or cookie policies were found, representing a compliance gap with GDPR and related regulations. Contact information is available primarily via phone and contact forms, but no verified company emails were found. Overall, the website is trustworthy and professional but would benefit from improved privacy compliance and enhanced security measures. The domain registration is consistent with the business claims, and no blocking or WAF challenges were detected, allowing full content access and analysis.

-
-
-
-
-
-
-
immigrationresidencyinvestmentlatvialegalservices+2 more
WordPressWooCommerceElementorjQuery+3

Partner Domains:

www.sbaltic.com
partner
2025-07-30T16:00:48.242Z
L

Lux Pet Club

luxpetclub.com

0
OtherLatviasmallMEDIUM

Lux Pet Club is a small local club based in Riga, Latvia, focused on dog and cat breeding, training, exhibitions, and related services. The website serves as an informational and service platform for pet enthusiasts, providing details about club activities, services, and contact information. The business targets pet owners and breeders in the local region, positioning itself as a community and service provider for pet care and education. Technically, the website is built on WordPress using the Astra theme and WooCommerce for e-commerce capabilities. It integrates common plugins such as Yoast SEO for search optimization and TranslatePress for multilingual support. The site is hosted likely via GoDaddy, with proper HTTPS enabled and Google Analytics for traffic monitoring. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS but lacks advanced security headers and DNSSEC. No privacy or cookie policies were found, indicating compliance gaps with GDPR and related regulations. No incident response or vulnerability disclosure information is provided, which could be improved. The WHOIS data is transparent and consistent with the business profile, enhancing trustworthiness. Overall, the site is functional and professional for its niche but should improve privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
60
57
75
100
petsdogclubcatclubbreedingtraining+4 more
WordPressWooCommerceYoast SEOjQuery+4
2025-07-30T16:00:48.220Z
C

Cenu Banka

cenubanka.lv

0
Real EstateLatviamediumMEDIUM

Cenu Banka is a Latvian company providing a comprehensive real estate transaction database and market analysis platform primarily targeting real estate professionals and private individuals in Latvia. The platform offers access to registered property transactions, listings, and user comments, supporting informed decision-making in the real estate market. Established since 2010, it serves over 150 companies and institutions, positioning itself as a leading data provider in the Latvian real estate sector. Technically, the website employs modern tracking and analytics tools such as Google Tag Manager and Facebook Pixel, uses HTTPS with CSRF protection on forms, and demonstrates good mobile optimization and SEO practices. Security posture is solid with encrypted connections and basic security best practices, though it lacks explicit security policies and advanced security headers. Privacy and cookie policies are present and indicate GDPR compliance. The absence of WHOIS data due to query limits limits full domain legitimacy verification, but the professional presentation, clear contact information, and client testimonials support a trustworthy business profile. Overall, the site is well-structured, content-rich, and professionally maintained, with moderate technical sophistication and a good security baseline.

30
43
2
70
75
75
100
realestatepropertydatamarketanalysislatviapropertytransactions+1 more
jQueryGoogle Tag ManagerFacebook PixelCookie Script
2025-07-30T16:00:48.189Z
mydesignpictures.com favicon

MyDesignPictures

mydesignpictures.com

0
E-commerceLatviasmallMEDIUM

MyDesignPictures is a small Latvian e-commerce business specializing in the sale of greeting cards, stationery, wrapping papers, and custom gifting products. The company operates a Shopify-based online store with a consistent brand presence and a focus on vintage aesthetics and natural wrapping materials. Their market position is that of a niche boutique retailer targeting consumers interested in unique and eco-friendly paper goods. Technically, the website leverages Shopify's platform, uses modern JavaScript libraries such as jQuery and LazySizes, and integrates Facebook Pixel and PayPal for analytics and payments. The site is mobile-optimized and performs moderately well, with good SEO and accessibility basics in place. Security-wise, the site enforces HTTPS and has domain transfer protections but lacks DNSSEC and explicit privacy or cookie policies, which are important for GDPR compliance. No incident response or vulnerability disclosure mechanisms are visible. Overall, the domain registration is consistent and trustworthy, supporting the legitimacy of the business. Recommendations include publishing comprehensive privacy and cookie policies, enabling DNSSEC, and adding security and incident response contact information to enhance trust and compliance.

75
35
17
35
65
80
100
e-commercestationerygiftwrappingshopifydesigncards+1 more
ShopifyjQueryLazySizesFacebook Pixel+1

Partner Domains:

paypal.com
partner
shopify.com
partner
2025-07-30T16:00:48.188Z
evauto.lv favicon

Auto tirdzniecība Jelgava | evauto.lv

evauto.lv

0
TransportationLatviasmallHIGH

The website evauto.lv represents a local Latvian used car dealership based in Jelgava, offering used car sales, leasing options, trade-in services, and car delivery from Europe. The business targets Latvian customers interested in purchasing used vehicles with flexible financing options. The site features a detailed car catalog with pricing and leasing information, supporting the business model of retail and leasing of used automobiles. From a technical perspective, the website employs common web technologies such as jQuery, FontAwesome, Google Fonts, and embedded YouTube videos. The site is mobile optimized and provides a good user experience with clear navigation and relevant content. However, no CMS or hosting provider information is discernible from the data. Performance is moderate, and SEO practices appear adequate with proper meta tags and Open Graph data. Security posture is moderate but could be improved. The site uses HTTPS (assumed from URL), includes a cookie consent banner, and avoids exposing sensitive data in HTML. However, no HTTP security headers were detected, and no security or incident response policies are published. The absence of WHOIS data limits domain legitimacy verification, but the website content and contact details appear consistent with a legitimate local business. Overall, the website is functional, professional, and safe for general audiences. The main risks relate to incomplete security headers, lack of published security policies, and missing WHOIS transparency. Strategic improvements in security configuration and compliance documentation would enhance trust and resilience.

35
10
17
60
72
75
-
usedcarsleasingcarsaleslatviajelgava+1 more
jQuery 3.5.1FontAwesome 5.8.2Google Fonts (Exo 2)YouTube embedded video iframe
2025-07-30T16:00:48.175Z
balticwoodtrade.lv favicon

SIA Baltic Wood Trade

balticwoodtrade.lv

0
EnergyLatviasmallCRITICAL

SIA Baltic Wood Trade is a Latvian company founded in 2017 specializing in the supply and sale of wood biomass products including pellets, briquettes, firewood, and charcoal. The company serves both local and international markets with a focus on premium quality and sustainability certifications such as ENplus, FSC, PEFC, and SBP. Their business model includes full-service delivery to customer locations, supporting both retail and wholesale clients. The website is professionally designed, multilingual, and provides clear contact channels and certifications to build trust. Technically, the website employs modern analytics and marketing tools including Google Analytics, Facebook Pixel, Microsoft Clarity, and Google reCAPTCHA v3 for form protection. The site uses HTTPS and has a cookie consent mechanism, but lacks some security headers and formal privacy and terms of service pages. Performance and mobile optimization are good, though accessibility could be improved. From a security perspective, the site demonstrates basic best practices but could enhance its posture by adding security headers, publishing privacy and incident response policies, and implementing a vulnerability disclosure mechanism. No critical vulnerabilities or suspicious content were detected. WHOIS data was unavailable due to query limits, limiting domain trust verification. Overall, the website and business appear legitimate and professional with moderate risk. Strategic improvements in privacy compliance and security hardening are recommended to enhance trust and regulatory adherence.

-
-
-
-
-
-
-
energywoodpelletsbiomasssustainabilitycertified+3 more
Google AnalyticsGoogle Tag ManagerFacebook PixelMicrosoft Clarity+1
2025-07-30T16:00:48.150Z
epdmshop.lv favicon

EPDM Shop SIA

epdmshop.lv

0
ManufacturingLatviasmallHIGH

EPDM Shop SIA is a Latvian-based company specializing in the supply of EPDM membranes and roofing solutions primarily for industrial and commercial applications. The company leverages well-known brands such as Firestone and Elevate to provide high-quality waterproofing and roofing membranes. Their website targets construction professionals, developers, and contractors seeking durable roofing materials. The business operates as a small regional supplier with a focus on B2B relationships. Technically, the website employs a traditional web stack including jQuery, Bootstrap, and Slider Revolution for UI components. While the site is mobile-optimized and presents content clearly, there are some technical gaps such as an empty Google Maps API key and lack of visible security headers. No CMS or hosting provider details are evident, and performance is moderate. From a security perspective, the site uses HTTPS (assumed from URL), but no explicit security headers were detected in the HTML content. The presence of a cookie consent banner indicates GDPR awareness and compliance efforts. However, the absence of WHOIS data due to query limits limits domain legitimacy verification. No forms collecting sensitive data were found, reducing immediate risk exposure. Overall, the website presents a professional and trustworthy front for a small manufacturing and supply business in Latvia. Security posture is average with room for improvement in headers and API key management. Privacy compliance is good with clear cookie consent. The lack of WHOIS data is a limitation but does not strongly detract from the business credibility based on website content and contact information.

50
28
17
70
-
75
-
epdmroofingmembranesconstructionlatvia+2 more
jQueryBootstrapFont AwesomeGoogle Fonts+2
2025-07-30T16:00:48.139Z