Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

149319
Websites
130
Industries
113
Countries
52
Avg Score
Page 58 of 120|Showing 2851-2900 of 5977
khaama.com favicon

The Khaama Press News Agency

khaama.com

73
MediaAfghanistanmediumMEDIUM

Khaama Press is an independent news agency focused on delivering reliable news from Afghanistan and around the world. It covers a broad range of topics including politics, security, business, refugee issues, and women's rights. The website positions itself as Afghanistan's leading independent news source, targeting a general audience interested in regional and global news. The business model revolves around news reporting and information dissemination, supported by advertising and donations. Technically, the website is built on WordPress with modern web technologies such as jQuery, Google Fonts, and Yoast SEO for search optimization. It uses Google reCAPTCHA for form security and Google Tag Manager for analytics. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms. However, some security headers are missing, and there is no security.txt or vulnerability disclosure page. Privacy compliance is partial, with a privacy policy and terms of use present but lacking a cookie consent mechanism. The WHOIS data is missing, which raises concerns about domain legitimacy, though the website content and social media presence support its credibility. Overall, Khaama Press is a professional and trustworthy news platform with room for improvement in security and privacy compliance. The absence of WHOIS data is a notable risk factor that should be monitored. Strategic recommendations include enhancing security headers, implementing cookie consent, and establishing a vulnerability disclosure process.

95
53
17
85
77
85
100
newsafghanistanmediapoliticsbusiness+3 more
WordPressjQueryGoogle FontsYoast SEO+3
2025-09-05T12:05:33.191Z
adelphic.com favicon

Viant Technology LLC

adelphic.com

72
TechnologyUnited StateslargeMEDIUM

Viant Technology LLC is a well-established advertising technology company specializing in programmatic demand side platform (DSP) solutions. Their flagship product, Adelphic DSP, enables advertisers and agencies to efficiently reach target audiences across multiple digital channels including Connected TV, streaming audio, mobile, and display. The company emphasizes data-driven, people-based targeting leveraging first-party data and advanced AI capabilities. Viant positions itself as a leader with over 20 years of innovation in advertising technology, serving a broad audience of advertisers, agencies, and media buyers. Technically, the website is built on WordPress with modern integrations such as Google Tag Manager, OneTrust for cookie consent, and analytics tools like Hotjar and Sentry, reflecting a mature digital infrastructure. The site is well-optimized for SEO and mobile devices, with comprehensive structured data and clear navigation. Security posture is strong with HTTPS, security headers, and form protections, though public security policies and incident response contacts are not disclosed. The absence of WHOIS data for the domain is a notable anomaly, potentially indicating recent registration or privacy protection, which slightly impacts trust but is mitigated by the professional presentation and detailed content. Overall, Viant demonstrates a robust business and technical presence with room to enhance transparency in security and compliance documentation.

65
88
17
80
62
85
100
dspprogrammaticadvertisingmarketingtechnologyomnichannelmarketingadvertisingplatform
WordPressGravity FormsGoogle Tag ManagerGoogle reCAPTCHA+6

Partner Domains:

experian.com
partner
2025-09-05T07:31:57.711Z
netlify.com favicon

Netlify

netlify.com

68
TechnologyN/alargeMEDIUM

Netlify is a leading technology platform specializing in composable web architecture, enabling developers and teams to build, deploy, and scale modern frontend applications efficiently. The platform offers a comprehensive suite of services including serverless infrastructure, edge functions, collaborative deploy previews, and instant rollbacks, all delivered via a global edge network. This positions Netlify as a key player in the Jamstack ecosystem, serving millions of developers and enterprise clients worldwide. Technically, the website demonstrates a mature digital infrastructure leveraging modern frameworks such as Astro and Preact, integrated with advanced analytics and marketing tools including Google Analytics, HubSpot, Segment, and Qualified.io. The site is optimized for performance, mobile responsiveness, and accessibility, reflecting a high level of digital maturity and user experience focus. From a security perspective, Netlify employs HTTPS and integrates Google reCAPTCHA Enterprise for bot mitigation, alongside cookie consent mechanisms to address privacy concerns. However, explicit security headers and publicly available security policies or vulnerability disclosure mechanisms are not evident, suggesting areas for improvement in transparency and security posture. Overall, the website is professional, trustworthy, and technologically advanced, with no indications of malicious activity or content safety concerns. The absence of public WHOIS data is likely due to privacy protection, common for technology companies. Strategic recommendations include enhancing security header implementation, publishing clear security and incident response policies, and improving privacy compliance disclosures to strengthen user trust and regulatory adherence.

40
80
2
87
70
85
100
webplatformjamstackserverlessfrontenddeploymentedgenetwork+2 more
AstroPreactGoogle reCAPTCHAHubSpot analytics and marketing scripts+4
2025-09-05T06:14:55.787Z
bloombergtax.com favicon

Bloomberg Industry Group, Inc.

bloombergtax.com

68
FinanceUnited StatesenterpriseMEDIUM

Bloomberg Industry Group, Inc. operates the Bloomberg Tax platform, providing comprehensive tax research software and financial information services to tax professionals and corporate decision makers. The website serves as a secure login portal for Bloomberg Tax products, reflecting Bloomberg's strong market position as a leading provider of financial data and research tools. The business model is subscription-based, targeting enterprise and professional users in the finance and tax sectors. Technically, the website employs modern web technologies including LitElement web components, Amplitude analytics, Adobe DTM for tag management, and Google reCAPTCHA for bot protection. The site is well-optimized for mobile devices and demonstrates good accessibility and SEO practices. The use of external trusted authentication widgets and secure HTTPS connections indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and uses CAPTCHA to protect login forms. However, explicit security headers are not detected in the provided data, and no published security or incident response policies were found. The WHOIS data is missing or unavailable, which is unusual but likely due to privacy protection or query limitations. Overall, the security posture is strong but could be improved by adding security headers and publishing vulnerability disclosure information. The overall risk assessment is moderate to low. The website is professional, trustworthy, and well-maintained, but the lack of WHOIS transparency and absence of some security policies suggest areas for improvement. Strategic recommendations include enhancing security headers, implementing cookie consent mechanisms, and publishing clear security and incident response policies to increase user trust and compliance.

60
53
17
70
77
85
100
financetaxresearchloginbloomberg+1 more
JavaScriptAmplitude AnalyticsGoogle reCAPTCHAAdobe DTM (Dynamic Tag Management)+2

Partner Domains:

pro.bloombergtax.com
partner
pro.bloomberglaw.com
partner

+2 more partners

2025-09-05T02:53:52.094Z
veritenews.org favicon

Deep South Today dba Verite News

veritenews.org

72
Non-profitUnited StatesmediumMEDIUM

Verite News is a nonprofit, Black-led news organization based in New Orleans, founded in 2022 and operated by Deep South Today. It focuses on producing in-depth journalism serving historically overlooked communities in New Orleans. The website offers news articles, newsletters, election guides, and multimedia content targeting local residents and stakeholders. The organization positions itself uniquely in the local media landscape with a strong community focus and nonprofit business model. Technically, the website is built on WordPress with a modern tech stack including Google Tag Manager, Google reCAPTCHA, and advertising via Google DoubleClick. It uses Cloudflare for DNS and domain registration, ensuring good performance and security. The site is mobile-optimized, accessible, and SEO-friendly, with comprehensive metadata and structured data enhancing discoverability. From a security perspective, the site enforces HTTPS, uses cookie consent mechanisms compliant with GDPR, and employs security best practices such as reCAPTCHA on forms. However, it lacks explicit security policies and incident response information. The WHOIS data is transparent and consistent with the organization's identity, enhancing trustworthiness. No critical vulnerabilities or suspicious patterns were detected. Overall, Verite News presents a professional, trustworthy, and well-maintained online presence suitable for its nonprofit journalism mission. Strategic improvements could include enabling DNSSEC, publishing security and incident response policies, and adding a vulnerability disclosure mechanism to further enhance security posture and stakeholder confidence.

35
100
25
75
75
80
100
newsnonprofitlocalnewsneworleansjournalism+8 more
WordPressPHPJavaScriptGoogle Tag Manager+5
2025-09-05T00:31:45.628Z
A

Apartments.com

apartments.com

57
Real EstateUnited StateslargeMEDIUM

Apartments.com is a leading online real estate rental marketplace focused on apartments, homes, townhomes, and condos for rent primarily in the United States. Owned by CoStar Group, the platform offers comprehensive rental listings, online application and lease signing capabilities, and property management tools. The website targets renters and property managers, providing extensive market data, calculators, and resources to facilitate rental decisions and property management. The brand is well-established with a large market presence and multiple subsidiary and partner sites under the CoStar umbrella. Technically, Apartments.com employs a modern and robust technology stack including Google Analytics, Google Tag Manager, Google Maps API, ReCaptcha, and performance monitoring tools like Boomerang. The site is hosted on a high-performance CDN likely Akamai, ensuring fast load times and excellent mobile optimization. The website is well-structured with strong SEO and accessibility features, providing a professional and user-friendly experience. From a security perspective, the site enforces HTTPS, uses ReCaptcha for bot mitigation, and implements cookie consent via OneTrust, demonstrating good privacy compliance and user protection. However, explicit security headers and a public security policy or incident response contacts are not evident, representing areas for improvement. The WHOIS data is unavailable due to query limitations, but the website's legitimacy is supported by its association with CoStar Group and consistent trust signals. Overall, Apartments.com presents a secure, professional, and comprehensive platform for rental listings and property management with strong business credibility and technical maturity. Strategic recommendations include enhancing security header implementation, publishing a security policy, and establishing a vulnerability disclosure program to further strengthen trust and compliance.

-
73
17
85
-
90
100
realestateapartmentsrentalspropertymanagementhousing+2 more
Google Tag ManagerGoogle AnalyticsGoogle Maps APIGoogle ReCaptcha+5

Partner Domains:

www.apartmentfinder.com
subsidiary
www.forrent.com
subsidiary

+3 more partners

2025-09-04T22:11:46.922Z
nutrient.io favicon

PSPDF US Inc.

nutrient.io

75
TechnologyUnited StatessmallMEDIUM

Nutrient, operated by PSPDF US Inc., is a technology company specializing in providing advanced PDF SDKs and document processing tools for developers and businesses. Their offerings include PDF viewing, editing, eSigning, workflow automation, and AI-powered document processing, positioning them as a leading provider in the document SDK market. The website reflects a professional and developer-focused business model, targeting enterprises and software developers who require seamless integration of document functionalities into their applications. The company holds a SOC 2 Type II certification, underscoring its commitment to security and compliance. Technically, the website is built on modern web technologies including Webflow CMS, Google Tag Manager, Cookiebot for consent management, and integrates analytics tools such as Plausible and Visual Website Optimizer. The site is well-optimized for mobile devices and demonstrates good SEO and accessibility practices. Security measures include HTTPS enforcement and bot protection via reCAPTCHA, although explicit security headers could be improved. From a security perspective, Nutrient shows a mature posture with certifications and privacy policies in place. However, there is room for enhancement in publishing vulnerability disclosure policies and incident response contacts. No critical vulnerabilities or exposed sensitive data were detected. The domain WHOIS data is privacy-protected, which is common and justified for technology companies. Overall, Nutrient presents a trustworthy and professional online presence with strong business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing a vulnerability disclosure policy, and providing clearer incident response contact information to further strengthen trust and compliance.

75
73
17
85
95
70
100
pdfsdkdocumenteditingesigningworkflowautomationlow-code+4 more
JavaScriptWebflow CMSGoogle Tag ManagerGoogle reCAPTCHA+4
2025-09-04T11:25:18.778Z
F

FoxESS Poland Sp. z o.o

forum-foxess.pro

51
EnergyPolandsmallMEDIUM

FoxESS Poland Sp. z o.o operates a specialized online forum dedicated to installers and users of FoxESS energy products, primarily focusing on inverters and energy storage solutions. The website serves as a community platform offering discussion boards, technical support, software update information, and user Q&A. The business targets a niche audience within the energy sector in Poland, positioning itself as a key resource for FoxESS product users. The company was founded in 2021 and maintains a small but focused online presence. Technically, the website is built on WordPress using the Divi theme and the wpForo plugin, supported by anti-spam measures such as CleanTalk and Google reCAPTCHA. The infrastructure is moderate in performance with good mobile optimization and basic SEO and accessibility features. Hosting and domain registration are consistent with the business location and identity, with no privacy protection on WHOIS data and a domain age appropriate for the business timeline. From a security perspective, the site enforces HTTPS and employs anti-spam and CAPTCHA protections. However, it lacks DNSSEC, security headers, and published security or incident response policies, which are areas for improvement. No critical vulnerabilities or blocking mechanisms were detected, and the site does not expose sensitive data. Privacy compliance is basic, with a privacy policy and cookie consent banner present but no advanced GDPR indicators. Overall, the website is a functional and moderately secure community platform with clear business credibility and contact information. Strategic improvements in security headers, DNSSEC, and incident response transparency would enhance its security posture and trustworthiness.

70
50
10
55
67
80
-
forumenergyfoxessdiscussionwordpress+1 more
WordPress 6.8.2Divi Theme 4.3.2wpForo Forum Plugin 1.9.9.1CleanTalk Anti-Spam+2
2025-08-04T14:49:56.784Z
nmi.com favicon

Network Merchants, LLC

nmi.com

56
FinanceUnited StatesenterpriseMEDIUM

Network Merchants, LLC (NMI) operates a leading embedded payments platform powering over $200 billion in annual payment volumes. The company provides a comprehensive suite of payment solutions including a customizable payments platform, merchant relationship management, and a flexible payment gateway. Their target audience includes Independent Sales Organizations, SaaS providers, banks, payment facilitators, and various industry verticals. NMI positions itself as a global leader in embedded payments with a strong market presence and extensive processor connections. Technically, the website is built on WordPress with modern JavaScript libraries and analytics tools such as Google Tag Manager, Woopra, and reCAPTCHA for security. The site is well-optimized for SEO, mobile responsiveness, and accessibility, reflecting a mature digital infrastructure. Security best practices are evident with HTTPS, Content Security Policy headers, and secure form handling. The security posture is strong with no visible vulnerabilities or exposed sensitive data. However, the site lacks explicit incident response contact information and a public vulnerability disclosure policy. Privacy compliance is robust with clear privacy and cookie policies, including GDPR considerations. The business credibility is high, supported by consistent WHOIS data, professional content, and multiple trust indicators. Overall, NMI's website reflects a secure, professional, and well-managed online presence suitable for an enterprise-level payment technology company.

15
53
2
60
52
80
100
paymentsembeddedpaymentspaymentgatewaymerchantmanagementfinance+3 more
JavaScriptGoogle Tag ManagerWoopra AnalyticsLazyLoad library+2
2025-08-04T12:31:33.027Z
aleet.co favicon

Aleet

aleet.co

37
TransportationPolandsmallHIGH

Aleet is a Polish technology company specializing in AI-powered fleet management and logistics optimization solutions. Their offerings include digital twin technology for operational strategy analysis and dynamic routing software, targeting transport companies across various sectors such as e-commerce, last-mile delivery, specialist transport, courier, and passenger transport. The company positions itself as an innovative provider improving operational efficiency and reducing costs for transport businesses. Technically, the website is built on WordPress with modern plugins like WPML for multilingual support and Contact Form 7 for user interaction. The site is hosted via GoDaddy with domain privacy protection enabled. Performance and mobile optimization are good, with SEO best practices implemented through the All in One SEO plugin. Security measures include HTTPS enforcement and Google reCAPTCHA on forms, though DNSSEC is not enabled and some security headers are not explicitly confirmed. From a security perspective, the site demonstrates a moderate security posture with room for improvement in DNS security and explicit security policies. Privacy compliance is basic, with a privacy policy present but no visible cookie consent mechanism. Contact information is clearly provided, enhancing business credibility. No signs of WAF blocking or malicious content were detected. Overall, Aleet presents a professional and trustworthy online presence suitable for its business domain. Strategic recommendations include enabling DNSSEC, adding security.txt for vulnerability disclosure, implementing cookie consent for GDPR compliance, and enhancing security headers to strengthen the security posture.

15
50
2
70
-
75
-
aifleetmanagementtransportlogisticswordpress+1 more
WordPress 6.8.2PHPjQueryAll in One SEO plugin+3
2025-08-04T09:30:51.653Z
entrapeer.com favicon

Entrapeer

entrapeer.com

61
TechnologyN/asmallMEDIUM

Entrapeer is a technology startup founded in 2021 that provides an AI-powered open innovation platform designed to help enterprises accelerate their innovation processes. The platform leverages AI agents to analyze vast libraries of vetted technology use-cases, market trends, and competitor data to deliver tailored insights and recommendations. Entrapeer targets large enterprises, Fortune 500 innovation teams, and Silicon Valley venture capitalists, positioning itself as a strategic innovation partner and always-on consultant. The business model is primarily B2B SaaS, focusing on delivering rapid, evidence-based innovation intelligence to enterprise clients. Technically, Entrapeer operates on a WordPress CMS with Elementor page builder, utilizing modern JavaScript libraries such as Swiper.js and GSAP for interactive UI elements. The site employs Google Tag Manager and Google reCAPTCHA for analytics and security. Hosting and domain registration are managed via GoDaddy and Cloudflare DNS services. The website demonstrates good SEO practices and mobile optimization, though performance is moderate and accessibility features are basic. From a security perspective, the website uses HTTPS with a good SSL configuration but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. Forms are protected with reCAPTCHA, but no explicit privacy or cookie policies were found, indicating potential compliance gaps. No incident response or vulnerability disclosure information is publicly available. Overall, Entrapeer presents a professional and trustworthy digital presence with strong business credibility and technical maturity. However, improvements in privacy compliance and security hardening are advised to align with best practices and regulatory requirements.

20
53
17
75
75
65
100
aiinnovationenterprisetechnologyopeninnovation+2 more
JavaScriptSwiper.jsGSAPGoogle Tag Manager+4
2025-08-04T08:21:29.543Z
web321.co favicon

Web321 Marketing Ltd.

web321.co

64
TechnologyCanadasmallMEDIUM

Web321 Marketing Ltd. is a small Canadian technology company specializing in web design, WordPress support, and website maintenance services. Established in 2020, it targets businesses and individuals primarily in Canada and nearby US regions. The company positions itself as a trusted webmaster and website support expert, offering affordable maintenance plans and professional web design solutions. The website reflects a professional and consistent brand image with clear contact information and active social media presence. Technically, the website is built on WordPress using the Divi theme and builder framework, leveraging modern web technologies including Google reCAPTCHA for spam protection and Google Tag Manager for analytics. Hosting and content delivery appear to be supported by Cloudflare DNS and Amazon S3 CDN, contributing to moderate performance and good mobile optimization. SEO and accessibility are implemented at a basic to good level. From a security perspective, the site enforces HTTPS and uses clientTransferProhibited domain status, indicating stable domain ownership. However, DNSSEC is not enabled and several important HTTP security headers are missing, which could be improved. No explicit security or incident response policies are published, and privacy and cookie policies are absent, indicating compliance gaps with GDPR and related regulations. Overall, the website is safe, professional, and trustworthy with a moderate security posture. Strategic improvements in privacy compliance, security headers, and incident response transparency would enhance the company's risk profile and customer trust.

20
53
25
85
75
80
100
webdesignwordpresssupportwebsitemaintenancesmallbusinesstechnology+1 more
WordPressDivi ThemeGoogle reCAPTCHAGoogle Tag Manager+1
2025-08-02T18:25:19.893Z
thecompetitionplatform.co.uk favicon

The Competition Platform

thecompetitionplatform.co.uk

67
MediaUnited KingdomsmallMEDIUM

The Competition Platform is a UK-based SaaS business founded in 2016, specializing in providing a platform that enables publishers, brands, and agencies to build, run, and analyze competitions effectively. The company targets a niche market of marketing professionals and media companies, boasting thousands of clients and recognizable brand partnerships. Their business model revolves around offering a digital platform service that streamlines competition management and analytics. Technically, the website is built on a custom stack utilizing Bootstrap, jQuery, Google reCAPTCHA, and FontAwesome, with a focus on responsive design and moderate performance. The site employs HTTPS with a valid SSL certificate and includes standard privacy and cookie policies, along with a cookie consent mechanism. However, some modern security headers are missing, and no explicit security or incident response policies are published. From a security perspective, the platform demonstrates good practices such as CSRF token usage and CAPTCHA protection on forms, but lacks a formal security policy and vulnerability disclosure program. No critical vulnerabilities or exposed sensitive data were detected. The domain registration is consistent with the business history and shows legitimacy, registered through a reputable registrar with a long-term expiry. Overall, the website presents a professional and trustworthy front with good content quality and technical implementation. Strategic improvements in security policy transparency and enhanced security headers would further strengthen their posture. The risk level is moderate to low, with no immediate critical issues identified.

50
83
2
70
77
70
100
competitionsplatformpublishersbrandsmarketing+1 more
BootstrapjQueryGoogle reCAPTCHAFontAwesome+2

Partner Domains:

blog.thecompetitionplatform.co.uk
related
2025-08-02T14:56:00.649Z
lunaproxy.com favicon

LunaProxy

lunaproxy.com

61
TechnologyN/amediumMEDIUM

LunaProxy operates as a technology-focused proxy service provider offering a comprehensive suite of proxy solutions including residential, ISP, datacenter, and rotating proxies, alongside scraping APIs. The company targets businesses and individuals requiring reliable and large-scale web data access, positioning itself as a major player with over 200 million IPs across 195 countries. The website is professionally designed, multilingual, and rich in content, supporting a broad international audience. Technically, LunaProxy employs modern web technologies such as Vue.js, jQuery, and Element UI, and integrates multiple analytics and marketing tools including Google Tag Manager and Microsoft Clarity, indicating a mature digital infrastructure. Security-wise, the site enforces HTTPS, uses security headers, and incorporates CAPTCHA mechanisms, but lacks publicly available security policies or incident response details, which could be improved to enhance trust. The absence of WHOIS domain registration data is a notable risk factor, reducing overall business credibility despite the professional web presence. Strategic recommendations include publishing detailed security and privacy policies, clarifying domain registration status, and enhancing transparency around compliance and certifications to strengthen trust and security posture.

15
58
17
70
65
85
100
proxyresidentialproxyispproxydatacenterproxyscraping+4 more
jQueryVue.jsElement UIGoogle Tag Manager+3
2025-08-02T11:29:41.161Z