Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 411 of 556|Showing 20501-20550 of 27753
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

54
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
klopp.law favicon

Klopp Law

klopp.law

53
OtherUnited StatessmallMEDIUM

Klopp Law is a veteran-owned criminal defense law firm based in Reading, Pennsylvania, specializing in defending clients against serious criminal charges such as drug offenses, gun cases, assaults, and DUI. The firm positions itself as a dedicated and aggressive advocate for clients in eastern Pennsylvania, emphasizing personalized legal representation and thorough case preparation. The website reflects a small but professional legal practice with a clear focus on criminal defense services. Technically, the website is built on WordPress using the PaperStreet theme framework, incorporating modern web technologies such as jQuery, Swiper.js for sliders, and lazy loading for images. SEO is well addressed with Yoast SEO plugin integration and proper meta tags. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Hosting is likely through GoDaddy, consistent with the domain registrar information. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks DNSSEC, visible security headers, and dedicated security or incident response policies. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms. The domain WHOIS data is consistent with the business claims, showing no privacy protection and a legitimate registration history. Overall, Klopp Law's website is a solid representation of a small legal practice with good business credibility and technical implementation but requires improvements in privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
70
52
75
100
legalcriminaldefenselawfirmpennsylvaniaveteran-owned+1 more
WordPressYoast SEO pluginjQuerySwiper.js+3

Partner Domains:

clients.clio.com
partner
app.clio.com
partner

+2 more partners

2025-07-07T10:08:46.369Z
crossandsmith.com favicon

Cross & Smith LLC

crossandsmith.com

55
OtherUnited StatessmallMEDIUM

Cross & Smith LLC is a well-established personal injury law firm operating primarily in Alabama with offices in Tuscaloosa and Birmingham. The firm specializes in accident and injury cases, boasting over 25 years of experience and significant verdicts and settlements exceeding $150 million. Their business model is client-focused with a contingency fee structure, targeting individuals seeking legal representation for personal injury matters. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, supporting a strong market position in the regional legal services sector. Technically, the website is built on WordPress using a custom theme by PaperStreet, incorporating modern web technologies such as Yoast SEO for search optimization, Google reCAPTCHA for form security, and CallRail for call tracking. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some accessibility features are basic and there is room for improvement in performance and security headers. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms from spam. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers like HSTS and CSP, and the lack of a published security or incident response policy, indicate areas for enhancement. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism or GDPR-specific disclosures. Overall, the website is trustworthy and professional, with a solid business credibility score. Strategic improvements in privacy compliance, security header implementation, and incident response transparency would further strengthen the firm's digital security posture and regulatory adherence.

15
35
17
70
42
75
100
personalinjurylawfirmlegalservicesalabamaattorneys+2 more
WordPressYoast SEOFontAwesomeGoogle reCAPTCHA+2
2025-07-07T10:08:16.290Z
ffslawfirm.com favicon

Fridman Fels & Soto, PLLC

ffslawfirm.com

60
FinanceUnited StatessmallMEDIUM

Fridman Fels & Soto, PLLC is a boutique law firm specializing in white collar criminal defense, securities litigation, and complex investigations, primarily serving U.S. and Latin American clients. Founded in 2019 by former federal prosecutors, the firm emphasizes personalized client service and expertise in criminal and commercial law. Their market position is that of a specialized, trusted legal service provider with a strong reputation bolstered by client testimonials and industry citations. Technically, the website is built on WordPress with a modern tech stack including Bootstrap, WPBakery Page Builder, and Slider Revolution. Hosting appears to be via WP Engine, ensuring reliable performance. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Analytics and marketing tools such as Google Analytics and HubSpot are integrated, indicating moderate user tracking. From a security standpoint, the site uses HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled and no explicit security headers were detected, suggesting room for improvement. Privacy compliance is weak due to the absence of visible privacy and cookie policies. No incident response or vulnerability disclosure information is published. Overall, the website presents a professional and trustworthy image with good business credibility but could enhance its privacy and security posture to meet higher compliance standards.

15
50
17
60
75
80
100
lawfirmwhitecollardefenselitigationmiamilegalservices+2 more
WordPressPHPjQueryBootstrap+5
2025-07-07T10:07:46.145Z
whova.com favicon

Whova

whova.com

73
TechnologyUnited StatesmediumMEDIUM

Whova is a well-established technology company founded in 2012, specializing in providing an all-in-one event management platform that supports in-person, hybrid, and virtual events. Their platform includes award-winning event apps, registration and ticketing software, event management tools, marketing solutions, and exhibitor management. The company targets a broad range of event organizers including corporate, academic, government, association, and trade show sectors. Whova has a strong market position supported by industry awards, customer testimonials, and press coverage. Technically, the website is built on WordPress using the Divi theme and leverages modern web technologies including jQuery, Google Fonts, and YouTube APIs. Hosting is via AWS infrastructure, and the site demonstrates good performance, mobile optimization, and SEO practices. Privacy and cookie compliance are robust, with a clear cookie consent mechanism and comprehensive privacy policies. From a security perspective, the site uses HTTPS with good SSL configuration but lacks DNSSEC and some advanced security headers. No vulnerabilities or exposed sensitive data were detected. However, the absence of a public incident response or vulnerability disclosure policy is noted. Overall, the security posture is solid but could be improved with additional transparency and DNS security. The website is professional, trustworthy, and safe for general audiences. It employs extensive user tracking for analytics and marketing purposes but maintains GDPR compliance. Contact information is clearly provided, including a company email and phone number. Social media presence on Twitter and LinkedIn supports engagement and trust. Strategic recommendations include enabling DNSSEC, adding security headers, publishing incident response and vulnerability disclosure information, and continuing to enhance privacy transparency to maintain and improve trust and security posture.

70
80
2
85
67
90
100
eventmanagementeventappeventregistrationhybrideventsvirtualevents+3 more
WordPressDivi ThemejQueryYouTube iframe API+6
2025-07-07T09:02:44.772Z
A

Afonso Digitalbyrå & Webbyrå

afonso.se

56
TechnologySwedensmallMEDIUM

Afonso Digitalbyrå & Webbyrå is a Stockholm-based digital agency specializing in headless e-commerce, web design, and app development. Established since 2008, the company has served over 100 clients, delivering award-winning digital solutions that drive business value and brand growth. Their key services include UX/UI design, WooCommerce development, backend systems, and mobile app creation, targeting businesses seeking to enhance their online presence and sales capabilities. The agency leverages modern technologies such as WordPress, Next.js, Laravel, and React, demonstrating a mature technical infrastructure with fast performance and excellent mobile optimization. From a security perspective, the website employs HTTPS with a strong SSL configuration and uses Cookiebot for GDPR-compliant cookie consent management. However, it lacks visible security headers and published security policies or incident response contacts, which are areas for improvement. No vulnerabilities or exposed sensitive data were detected. The domain registration is consistent with the business claims, showing a long-standing presence and trustworthy legitimacy. Overall, the website presents a professional, well-structured, and secure digital agency platform with strong business credibility. The absence of privacy and terms of service pages slightly impacts privacy compliance scores. Strategic enhancements in security policy transparency and DNS security would further strengthen their security posture and trustworthiness.

30
25
17
55
72
65
100
digitalagencywebdesignheadlessecommerceappdevelopmentsweden+4 more
WordPressWooCommercePHPNuxt+8
2025-07-07T08:58:02.969Z
lbresearch.com favicon

Law Business Research

lbresearch.com

71
TechnologyUnited KingdomlargeMEDIUM

Law Business Research (LBR) is a UK-based technology-driven information services company specializing in providing intelligence and insights to the global legal, intellectual property, and governance, risk, and compliance markets. The company offers a range of platforms and tools designed to help legal professionals, law firms, corporates, academics, and government agencies make informed decisions through data-driven insights. LBR positions itself as a fast-growing and innovative leader in its sector, serving a diverse and international client base including major law firms and FTSE100 companies. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO and Google Analytics. The presence of Cloudflare bot management cookies suggests a robust hosting and security infrastructure. The site is mobile-optimized and demonstrates good performance and accessibility standards, although some security headers could be improved. Privacy compliance is well addressed with clear cookie consent mechanisms and comprehensive privacy and cookie policies. From a security perspective, the site enforces HTTPS and employs cookie consent blocking for scripts until user approval. However, it lacks explicit security policy documentation and incident response contacts, which are recommended for enhanced trust and compliance. The absence of WHOIS registration data raises minor concerns but does not critically impact the overall legitimacy given the professional presentation and business information. Overall, LBR's website reflects a mature digital presence with strong business credibility and compliance posture, suitable for its professional audience. Strategic improvements in security transparency and WHOIS registration clarity would further enhance trust and security posture.

60
80
17
80
65
80
100
legalresearchintelligencetechnologycompliance+4 more
WordPressYoast SEO pluginjQueryCloudflare (inferred from cookie __cf_bm)+3
2025-07-07T07:50:35.256Z
earlychildhoodaustralia.org.au favicon

Early Childhood Australia

earlychildhoodaustralia.org.au

61
EducationAustraliamediumMEDIUM

Early Childhood Australia is a well-established non-profit organization dedicated to advocacy, professional development, and resource provision for early childhood education in Australia. The website serves as a comprehensive platform offering publications, events, membership services, and educational resources targeted at educators, parents, and policymakers. The organization maintains a strong market position as a national peak body in its sector. Technically, the website is built on WordPress with a modern technology stack including Bootstrap, jQuery, and various analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and Hotjar. The site demonstrates good performance, mobile optimization, and accessibility features, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS, uses Google reCAPTCHA on forms, and integrates tracking pixels responsibly. While explicit security headers are not fully visible in the provided content, the overall posture is good with no evident vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR considerations. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. Strategic recommendations include enhancing security headers, publishing a formal security policy and vulnerability disclosure, and continuing regular security audits to maintain and improve the security posture.

15
65
17
70
72
60
100
educationnon-profitearlychildhoodadvocacyprofessionaldevelopment+1 more
WordPressPHPjQueryBootstrap 3.4.1+7

Partner Domains:

shop.earlychildhoodaustralia.org.au
partner
learninghub.earlychildhoodaustralia.org.au
partner

+3 more partners

2025-07-07T07:48:50.029Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

56
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z
naag.org favicon

National Association of Attorneys General

naag.org

65
GovernmentUnited StatesmediumMEDIUM

The National Association of Attorneys General (NAAG) operates as a nonpartisan national forum dedicated to empowering and supporting attorneys general across the United States. The organization provides training, research, policy advocacy, and resources through various centers and initiatives, positioning itself as a key resource and collaborative platform for legal professionals in government. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to its target audience. Technically, the site is built on WordPress with modern plugins and integrations such as Gravity Forms, Google Tag Manager, and Hotjar, indicating a well-maintained infrastructure. The site is mobile-optimized and accessible, with good SEO practices and structured data enhancing search visibility. Security measures include HTTPS enforcement and multiple security headers, contributing to a strong security posture. However, the absence of explicit privacy and cookie policies and the lack of WHOIS registration data introduce some concerns regarding transparency and compliance. While the site uses tracking and analytics tools, it lacks visible GDPR compliance mechanisms such as cookie consent banners. Overall, the security posture is solid but could be improved with clearer privacy disclosures and incident response information. The risk assessment suggests a generally trustworthy and professional site with moderate risk due to missing WHOIS data and privacy policy gaps. Strategic recommendations include publishing comprehensive privacy and cookie policies, implementing consent mechanisms, and enhancing transparency around security and data protection practices.

30
73
47
65
52
75
100
governmentlegalattorneysgeneralnonprofittraining+3 more
WordPressGravity FormsGoogle Tag ManagerHotjar+5
2025-07-07T06:43:57.298Z