Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 41 of 1064|Showing 2001-2050 of 53176
C

Carlsons Solicitors

carlsonssolicitors.com

66
Real EstateUnited KingdomsmallMEDIUM

Carlsons Solicitors is a full-service law firm based in London, serving both national and international clients. The firm is recognized in The Legal 500 UK 2026, indicating a strong market position and reputable service offering. Their key services include family law, residential conveyancing, probate, debt recovery, immigration, and dispute resolution. The website targets individuals and businesses seeking professional legal assistance, emphasizing client relationships and personalized service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Google Analytics, Google Tag Manager, and the Plyr video player. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, typical for a CMS-based site with multimedia content. From a security perspective, the site enforces HTTPS and implements a cookie consent banner, but lacks advanced security headers such as HSTS and Content-Security-Policy. No explicit security or incident response policies are published, which could be improved to enhance trust and compliance. The WHOIS data is unavailable, which reduces transparency and trustworthiness, though the professional content and client testimonials mitigate some concerns. Overall, the website presents a professional and trustworthy image suitable for a law firm, but could benefit from enhanced security practices and clearer privacy documentation to improve compliance and user trust.

80
54
100
75
17
35
95
lawfirmlegalservicesfamilylawconveyancingdisputeresolution+2 more
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerjQuery+2
2026-06-27T07:09:03.204Z
yoma.co.uk favicon

Yoma Digital Ltd

yoma.co.uk

70
E-commerceUnited KingdommediumMEDIUM

Yoma Digital Ltd is a UK-based full-service digital agency specializing in ecommerce development, digital marketing, and ERP integrations, notably as an exclusive Epicor Commerce partner in the UK and Ireland. The company offers a comprehensive suite of services including custom ecommerce stores, SEO, PPC, CRO, content marketing, and hosting solutions tailored to ecommerce businesses. Their market position is strengthened by strategic partnerships with major ecommerce platforms and ERP providers, supported by client testimonials and a professional online presence. Technically, the website is built on WordPress with modern integrations such as Google Tag Manager, Microsoft Clarity, LinkedIn Insight, and reCAPTCHA v3 for security. The site demonstrates good mobile optimization, SEO practices, and accessibility features. Hosting and domain registration are consistent with the company's UK base, though DNSSEC is not enabled. Security posture is solid with HTTPS enforced, secure forms, and cookie consent mechanisms in place. However, there is room for improvement in implementing comprehensive security headers and publishing explicit security policies. No vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy, professional, and well-structured digital presence with strong business credibility and compliance with privacy regulations. Strategic recommendations include enhancing DNS security, security headers, and formalizing incident response policies to further strengthen security and trust.

47
75
100
85
83
2
80
ecommercedigitalmarketingseoppcmagento+5 more
WordPressPHPjQueryGoogle Tag Manager+4
2026-06-27T07:08:20.574Z
T

The Incredibly Useful Company Limited

incrediblyuseful.net

54
TechnologyUnited KingdomsmallMEDIUM

The Incredibly Useful Company Limited is a small UK-based web design and development consultancy specializing in Umbraco CMS solutions. The company targets SMEs and businesses worldwide, offering services including web design, development, ecommerce, systems integration, hosting, training, and consultancy. Their market position is that of an agile, expert provider with a focus on personalized client service and rapid response. Technically, the website is built on Umbraco CMS, hosted by UmbHost, and uses modern web technologies including Google Fonts and Google Analytics. The site is mobile-optimized with good navigation and SEO practices, though accessibility features are basic. Performance is moderate, and the site uses HTTPS. From a security perspective, the site lacks explicit security headers and privacy/cookie policies, which are critical for compliance and user trust. No WHOIS data was found, which raises concerns about domain registration legitimacy. However, the website content is professional and consistent with a legitimate business. Overall, the site presents a moderate risk profile with room for improvement in privacy compliance, security hardening, and domain registration transparency. Strategic recommendations include implementing privacy and cookie policies, adding security headers, and verifying domain registration details to enhance trust and compliance.

45
35
2
70
32
75
100
webdesignwebdevelopmentumbracocmsecommerceconsultancy+2 more
Google FontsUmbraco CMSJavaScriptCSS+2
2026-06-27T07:07:48.681Z
kendallkingscott.co.uk favicon

Kendall Kingscott

kendallkingscott.co.uk

54
Real EstateUnited KingdommediumMEDIUM

Kendall Kingscott is a well-established inter-disciplinary construction consultancy based in the UK, with a 60-year history of providing integrated architectural, surveying, project management, and low carbon consultancy services. The company targets clients in sectors such as education, healthcare, residential, commercial, and public sectors, emphasizing a holistic and collaborative approach branded as '1 Team'. The website reflects a mature digital presence with professional design, multimedia content, and clear navigation. Technically, the site uses modern JavaScript modules, Google Tag Manager for analytics, and Vimeo for video content, indicating a moderate to advanced digital infrastructure. Security posture is generally good with HTTPS and cookie consent mechanisms in place, but lacks explicit security headers and visible incident response policies. The domain WHOIS data is unavailable due to a naming rules violation error from Nominet UK, which is unusual and reduces domain trustworthiness, though the website content and business information appear legitimate and professional. Overall, the site scores well on content quality, technical implementation, and privacy compliance, but domain registration opacity and missing security policies slightly reduce the trust score.

40
70
27
90
55
2
68
constructionconsultancyarchitectureprojectmanagementbuildingsurveying+2 more
JavaScript ES modulesGoogle Tag ManagerVimeo video embeddingFlickity carousel+2

Partner Domains:

ournameismud.co.uk
partner
2026-06-27T07:07:00.876Z
ulyettlandscapes.com favicon

Ulyett Landscapes Ltd

ulyettlandscapes.com

55
Real EstateUnited KingdommediumMEDIUM

Ulyett Landscapes Ltd is a well-established landscaping and grounds maintenance company based in the United Kingdom, founded in 1967. The company serves both commercial and domestic clients, maintaining over 300 sites and offering a wide range of services including tree surgery, artificial grass installation, hard and soft landscaping, fencing, and seasonal services such as gritting and snow clearance. Their market position is strong within the East Midlands region, supported by multiple industry certifications and a solid reputation evidenced by positive customer reviews. The website reflects a professional business model focused on service delivery and client satisfaction. Technically, the website is built on WordPress using modern plugins such as Yoast SEO, Contact Form 7, and Complianz GDPR Cookie Consent, indicating a mature digital infrastructure. The site is mobile-optimized, SEO-friendly, and integrates Google Tag Manager and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement and CAPTCHA protection on forms, although some security headers are not explicitly detected and DNSSEC is not enabled, representing areas for improvement. From a security perspective, the website demonstrates good practices with no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust with clear cookie consent mechanisms and a comprehensive privacy policy. However, there is no explicit incident response or vulnerability disclosure information available, which could be enhanced to improve security posture. Overall, the domain registration data aligns well with the business claims, supporting the legitimacy and trustworthiness of the site. The overall risk assessment is low, with the website presenting a professional, secure, and compliant digital presence. Strategic recommendations include implementing additional security headers, enabling DNSSEC, and adding incident response contact details to further strengthen…

100
85
50
-
15
10
95
landscapinggroundsmaintenancetreesurgeryartificialgrasscommerciallandscaping+3 more
WordPressYoast SEOContact Form 7Complianz GDPR Cookie Consent+5
2026-06-27T07:06:39.639Z
annodata.co.uk favicon

Kyocera-Annodata

annodata.co.uk

76
TechnologyUnited KingdommediumLOW

Kyocera Annodata is a UK-based managed services provider specializing in digital transformation solutions including cloud, IT infrastructure, collaboration tools, content services, and cybersecurity. The company positions itself as a leading MSP in the UK market, leveraging its parent company Kyocera's brand and expertise. Their website reflects a professional and modern digital presence with a focus on business clients seeking innovative IT solutions. The business model centers on managed services and technology enablement for enterprises and mid-sized organizations. Technically, the website is built on WordPress with Elementor, integrating advanced analytics tools such as Google Analytics and Adobe Analytics, alongside a robust cookie consent mechanism via Cookiebot. The site demonstrates good SEO practices, mobile optimization, and moderate performance. Hosting is provided by GoDaddy, and the domain registration is consistent with the company's founding date in 2022. From a security perspective, the website enforces HTTPS with DNSSEC enabled and uses cookie consent to comply with GDPR. However, explicit security policies and incident response contacts are not published, and no vulnerability disclosure or security.txt file is present. The site uses third-party scripts managed through Google Tag Manager and Adobe Launch, which should be regularly audited to mitigate risks. Overall, the website is trustworthy and professional with a good security posture but could improve transparency around security policies and incident response. The domain registration data supports legitimacy, and no suspicious activity or content safety concerns were detected.

67
70
85
100
95
47
65
digitaltransformationcloudsolutionsitservicesmanagedserviceskyocera+3 more
WordPress 7.0Elementor 4.1.3Google Analytics (MonsterInsights)Cookiebot+2

Partner Domains:

kyoceraservice.co.uk
partner
shop.annodata.co.uk
partner

+1 more partners

2026-06-27T07:05:46.584Z
nidd-transport.com favicon

Nidd Transport Limited

nidd-transport.com

51
TransportationUnited KingdommediumMEDIUM

Delamode Nidd is a UK-based transport and logistics company specializing in UK and European distribution, warehousing, and freight forwarding services. Operating from Ripon, North Yorkshire, the company leverages over 35 years of experience and is a shareholder member of the Palletforce network, enhancing its market reach and operational efficiency. The website reflects a professional business presence targeting B2B customers requiring reliable and express delivery services across Europe. Technically, the site is built on WordPress with modern JavaScript libraries and integrates Google Analytics and ShareThis for tracking and social sharing. The site is mobile-optimized and well-structured, though some accessibility features could be improved. Security posture is adequate with HTTPS enabled but lacks visible security headers and incident response information. The absence of WHOIS data for the domain raises concerns about domain registration transparency, though the business information on the site appears legitimate. Overall, the site scores well on content quality and business credibility but should improve privacy compliance and security best practices.

20
60
53
17
75
70
37
transportlogisticswarehousingfreightforwardingukdistribution+3 more
WordPress 6.8.2jQuery 2.0.3 and 3.7.1Google AnalyticsGoogle Tag Manager+3

Partner Domains:

xpediator.com
parent
palletforce.com
partner

+1 more partners

2026-06-27T07:05:20.032Z
wakefieldacoustics.co.uk favicon

Wakefield Acoustics

wakefieldacoustics.co.uk

66
EnergyUnited KingdommediumMEDIUM

Wakefield Acoustics is a UK-based company specializing in industrial noise control solutions, including acoustic enclosures, containers, louvres, and consultancy services. Established in 1999, the company serves industrial clients primarily in the energy and manufacturing sectors, offering design, manufacturing, and installation services to ensure compliant and sustainable operations. The website reflects a professional and consistent brand image, with clear navigation and relevant content tailored to its target audience. Technically, the site is built on WordPress with modern optimization tools like NitroPack and uses standard web technologies such as jQuery and Font Awesome. Performance and mobile optimization are good, contributing to a positive user experience. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though the absence of explicit security headers and security policies suggests room for improvement. Privacy compliance is limited due to missing privacy and cookie policies, which should be addressed to meet GDPR requirements. Overall, the domain registration data supports the legitimacy of the business, and the partnership with CECO Environmental adds trust. Strategic recommendations include enhancing privacy compliance, publishing security policies, and implementing security headers to strengthen the security posture.

52
100
70
70
17
53
80
industrialnoisecontrolacousticenclosuresnoisecontrolservicesukmanufacturing+1 more
WordPressNitroPack optimizationjQuerySlick Carousel+2

Partner Domains:

cecoenviro.com
partner
2026-06-27T07:04:58.647Z
farmingmonthly.co.uk favicon

Farming Monthly Ltd

farmingmonthly.co.uk

45
EnergyUnited KingdommediumHIGH

Farming Monthly Ltd operates a well-established UK-based digital and print media platform focused on farming and agriculture news, events, and classifieds. The website serves a professional audience including farmers, landowners, and agricultural professionals, offering comprehensive sector news, event information, and advertising opportunities. The company maintains a consistent brand presence with active social media channels and a digital magazine edition. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO, Google Analytics, and Google Tag Manager. It integrates social media SDKs and streaming content from Spotify, enhancing user engagement. The site demonstrates good mobile optimization and moderate performance, with room for improvement in accessibility and security headers. Security posture is solid with HTTPS enforced, secure form handling, and cookie consent mechanisms in place. However, the absence of explicit security headers and incident response policies suggests opportunities to strengthen defenses and compliance. No vulnerabilities or suspicious activities were detected in the content or scripts. Overall, the site presents a low-risk profile with professional content and business credibility. The WHOIS data is unavailable due to query errors, but the domain and content consistency support legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and improving accessibility compliance to further solidify trust and resilience.

57
55
50
20
73
15
10
farmingagriculturenewsukmagazine+5 more
WordPressYoast SEO pluginjQueryGoogle Analytics+4
2026-06-27T07:01:04.670Z
wessexdrainservices.co.uk favicon

Wessex Drain Services Ltd

wessexdrainservices.co.uk

50
OtherUnited KingdomsmallMEDIUM

Wessex Drain Services Ltd is a reputable local drainage company based in Bruton, UK, with over 30 years of experience. They offer a comprehensive range of drainage services including septic tank emptying, installation, drainage repair, sewage treatment plant installation, and homebuyers drain surveys. The company is registered with the Environment Agency and serves residential and commercial clients primarily in Somerset, Dorset, and Wiltshire. Their market position is that of a trusted local service provider with competitive pricing and strong customer satisfaction as evidenced by positive reviews and testimonials. Technically, the website is built on WordPress using Elementor and several reputable plugins such as Yoast SEO and Complianz GDPR for SEO and privacy compliance. The site is well-structured, mobile-optimized, and includes modern tracking tools like Google Analytics and Google Tag Manager. Performance is moderate with good SEO and accessibility basics in place. From a security perspective, the site uses HTTPS with a good SSL configuration and implements cookie consent mechanisms. However, there is no explicit security policy or incident response information available. No vulnerabilities or exposed sensitive data were detected. The domain registration data is consistent with the business claims, showing a long-standing domain without privacy protection, which supports legitimacy. Overall, the website presents a professional and trustworthy image with solid business credibility and compliance with privacy regulations. Strategic recommendations include enhancing security headers, publishing a security policy, and maintaining regular updates to plugins and core software to ensure ongoing security and compliance.

47
60
70
40
15
85
2
drainageseptictankdrainunblockingdrainrepairsewagetreatment+3 more
WordPressElementorYoast SEOGoogle Analytics+3
2026-06-27T07:00:38.128Z
scandia.co.uk favicon

Scandia Refrigeration Ltd

scandia.co.uk

51
ManufacturingUnited KingdommediumMEDIUM

Scandia Refrigeration Ltd is a UK-based manufacturer specializing in bespoke coldrooms, modular coldrooms, freezer rooms, and refrigeration systems. With over 40 years of industry experience, the company serves a diverse range of sectors including food, healthcare, and mortuary services. Their business model focuses on manufacturing, installation, and maintenance of cold storage solutions, positioning them as a leading player in their niche market. The website reflects a professional and consistent brand image with clear contact channels and customer testimonials, supporting their market credibility. Technically, the website employs a moderate technology stack including jQuery, Google Tag Manager, and Google Analytics, with asynchronous script loading to optimize performance. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, there is room for improvement in accessibility and SEO best practices. From a security perspective, the site uses HTTPS and standard tracking technologies but lacks visible security headers and formal privacy or cookie policies, indicating compliance gaps. The WHOIS data is unavailable and indicates the domain name is invalid per Nominet UK rules, which raises concerns about domain legitimacy. Despite this, the website content and contact information suggest a legitimate business operation. Overall, the site scores moderately well in content quality and business credibility but needs to address privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
70
52
60
100
coldroomsrefrigerationmanufacturingmodularcoldroomsindustrialcoldstores+4 more
jQuery 3.2.1Google Tag ManagerGoogle AnalyticsFinsbury Media tracking
2026-06-26T07:27:21.066Z
pressleakage.com favicon

Press Leakage Control Services Ltd

pressleakage.com

45
EnergyUnited KingdomsmallHIGH

Press Leakage Control Services Ltd (PLCS Ltd) is a UK-based company specializing in pipeline corrosion protection and leakage control solutions, serving the gas, water, and utilities sectors. With over 40 years of experience, the company positions itself as a world leader and pioneer in its industry, offering durable polymer-based coatings, rapid leakage repair systems, and comprehensive technical support including installation and training. The website reflects a professional B2B service provider with clear contact channels and accreditations, targeting utility companies and industrial clients. Technically, the website is built on WordPress using common plugins such as Slider Revolution and Contact Form 7, with integration of Google Analytics and Tag Manager for user tracking. The site is mobile-optimized with good SEO and accessibility basics, though some improvements in accessibility and security headers could be made. Performance is moderate, and the site uses HTTPS with a valid SSL configuration. From a security perspective, the site implements cookie consent mechanisms and does not expose sensitive data. However, no explicit security policy or incident response information is provided, and security headers are minimal. The absence of WHOIS domain registration data is a notable concern, as it reduces trust in domain legitimacy despite the professional appearance of the site. Overall, the website is safe, professional, and compliant with GDPR privacy requirements. The main risk lies in the missing WHOIS data, which should be investigated further to confirm domain registration legitimacy. Strategic recommendations include enhancing security headers, publishing a vulnerability disclosure or incident response policy, and verifying domain registration details to improve trust and compliance.

47
70
-
80
15
2
65
corrosionprotectionleakagecontrolpipelineservicesutilitiesuk+2 more
WordPressjQuerySlider RevolutionContact Form 7+6
2026-06-26T07:26:33.678Z
rdjohns.co.uk favicon

R D Johns

rdjohns.co.uk

45
RetailUnited KingdommediumHIGH

R D Johns Limited is a well-established family-run food wholesaler operating primarily in the South West of England. With over 50 years of experience, the company serves a broad range of food service businesses including restaurants, pubs, and catering services. The website reflects a mature business with a strong market position, offering extensive product catalogs, online ordering, and promotional materials to support its customers. The company maintains active social media channels to engage with its audience and enhance brand visibility. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Google Tag Manager, indicating a good level of digital maturity. The site is mobile-optimized and uses HTTPS with reCAPTCHA for form security, though it lacks some advanced security headers and explicit privacy and cookie policies. Performance is moderate, and accessibility is basic but functional. From a security perspective, the site demonstrates good practices like HTTPS and form protection but could improve by implementing security headers and publishing clear privacy and cookie policies to enhance GDPR compliance. No critical vulnerabilities or suspicious activities were detected. The domain registration is consistent with the business claims, showing a long-standing presence and legitimacy. Overall, the website is professional and trustworthy but would benefit from enhanced privacy compliance and security hardening to meet modern standards fully.

17
70
20
65
30
17
58
foodwholesalerfamilybusinesssouthwestenglandbutcheryproductbrochure+2 more
WordPress 7.0Yoast SEO pluginjQuery 3.7.1Google Tag Manager+6

Partner Domains:

rdjohns.coldweb.co.uk
service
hub.rdjohns.co.uk
service
2026-06-26T07:26:07.551Z
infor.com favicon

Infor Inc.

infor.com

76
TechnologyUnited StatesenterpriseLOW

Infor Inc. is a global leader in industry-specific cloud-based ERP and enterprise software solutions, serving manufacturers, distributors, healthcare organizations, public sector agencies, and service industries worldwide. The company offers comprehensive industry suites embedded with analytics, artificial intelligence, and automation to enable innovation and operational efficiency. The website reflects a mature digital presence with a professional design, clear navigation, and extensive content tailored to enterprise customers. Technically, the site leverages modern frameworks such as Next.js and React, integrates Google Tag Manager and reCAPTCHA for analytics and security, and demonstrates excellent mobile optimization and SEO practices. Security posture is strong with HTTPS enforcement, security headers, and cookie consent mechanisms, although explicit security policies and incident response contacts are not publicly detailed. Overall, Infor's website projects high trustworthiness and business credibility, despite the unusual absence of WHOIS registration data, which may be due to privacy or registry policies. Strategic recommendations include publishing detailed security policies and vulnerability disclosure information to enhance transparency and compliance.

80
88
17
88
57
90
100
enterprisesoftwareclouderpbusinesssoftwaretechnologyb2b+2 more
ReactNext.jsGoogle Tag ManagerGoogle reCAPTCHA+1

Partner Domains:

www.kochinc.com
parent
2026-06-26T07:23:22.771Z
klarquist.com favicon

Klarquist Sparkman, LLP

klarquist.com

67
TechnologyUnited StatesmediumMEDIUM

Klarquist Sparkman, LLP is a well-established intellectual property law firm based in Portland, Oregon, with a history dating back to 1941. The firm specializes in patent prosecution, trademark and copyright management, and IP litigation, primarily serving science and technology companies. Their market position is strong as one of the oldest and largest full-service IP firms on the West Coast, with a notable client base including major corporations such as Amazon and Microsoft. The website reflects a professional and comprehensive presentation of their services and personnel. Technically, the website is built on WordPress and employs modern web technologies including HTML5, CSS3, JavaScript, and libraries such as jQuery and Swiper.js. It integrates Google Tag Manager and Google Analytics for tracking and marketing purposes. The site is mobile-optimized and performs moderately well, with good SEO and accessibility basics in place. From a security perspective, the site uses HTTPS with a valid SSL certificate and has domain transfer protections enabled. However, it lacks DNSSEC and does not implement common security headers, which are recommended for enhanced protection. There is no visible security or incident response policy published on the site, and cookie consent mechanisms are absent despite the presence of a cookie policy. Overall, the website is trustworthy, professional, and safe for general audiences. The domain's long age and consistent registration details support the legitimacy of the business. Strategic improvements in security headers, cookie consent, and published security policies would further strengthen the firm's digital security posture and compliance standing.

44
100
85
80
45
47
53
intellectualpropertylawfirmpatenttrademarklitigation+2 more
HTML5CSS3JavaScriptjQuery+3

Partner Domains:

patentdefenses.com
partner
2026-06-26T07:23:01.850Z
nesgt.com favicon

NES Fircroft

nesgt.com

75
EnergyUnited KingdomlargeMEDIUM

NES Fircroft is a globally recognized leader in technical and engineering recruitment, providing workforce solutions across multiple sectors including Oil & Gas, Power & Renewables, Chemicals, Construction, Life Sciences, Mining, IT, and Manufacturing. With over 90 years of combined experience, the company supports over 25,000 contractors worldwide and operates numerous offices across Europe, North America, Asia, and other regions. Their business model focuses on contract staffing, permanent hire, employer of record services, and technical consultancy, positioning them as a comprehensive recruitment partner for technical industries. Technically, the website employs modern frameworks such as Bootstrap 5 and integrates advanced analytics and marketing tools including Google Analytics, Microsoft Clarity, and CookieYes for consent management. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Hosting and CDN services appear to be provided by WeAreVennture and Akamai, ensuring reliable performance. From a security perspective, the site enforces HTTPS, uses Google reCAPTCHA for bot protection, and manages cookies with user consent mechanisms. While explicit security headers are not fully visible in the HTML, the presence of bot management and consent tools indicates a mature security posture. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a professional, trustworthy, and compliant digital presence. However, the WHOIS data is incomplete or unavailable, which introduces some uncertainty regarding domain registration legitimacy. This discrepancy should be further investigated to ensure full trustworthiness.

62
85
100
80
90
83
17
recruitmentengineeringtechnicalstaffingenergyworkforcesolutions+3 more
Bootstrap 5jQuery UIGoogle Tag ManagerGoogle Analytics+4

Partner Domains:

www.nesadvantage.com
partner
careers.nesfircroft.com
related
2026-06-26T07:21:01.395Z