Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157327
Websites
130
Industries
113
Countries
52
Avg Score
Page 4 of 71|Showing 151-200 of 3533
W

Wastewater Management Limited

wastewatermanagement.co.uk

40
EnergyUnited KingdomsmallHIGH

Wastewater Management Limited operates as a specialized technical services provider in the wastewater treatment industry, focusing on operational optimization, performance testing, and wastewater analysis. The company targets wastewater industry professionals and plant operators, offering services such as oxygen transfer efficiency testing, mixing efficiency testing, and laboratory wastewater analysis. The website content is professional and well-structured, reflecting a niche market position within the energy sector focused on wastewater treatment. Technically, the website employs a modern front-end stack including Bootstrap, jQuery, and various UI libraries, with Google Fonts and Google Maps integration. The site is moderately optimized for mobile devices and offers a good user experience, though accessibility and SEO optimizations are basic. No CMS or hosting provider details are evident from the content. From a security perspective, the site lacks visible HTTPS enforcement and security headers, and no privacy or cookie policies are present, indicating a low maturity in security and privacy compliance. The WHOIS data is unavailable due to domain registration failure, which raises concerns about domain legitimacy despite the professional website content. No forms or user data collection mechanisms are detected, reducing immediate data exposure risks. Overall, the site presents a moderate risk profile with recommendations to implement HTTPS, security headers, and privacy policies to improve trust and compliance. The domain registration inconsistency should be investigated further to ensure legitimacy and reduce potential reputational risks.

50
47
20
55
35
2
50
wastewaterwastewatermanagementoxygentransferefficiencyeffluenttreatmentperformancetesting+2 more
BootstrapFontAwesomejQueryOwlCarousel+4

Partner Domains:

thebathroomshop.atlanticvision.uk
partner
wastewater.atlanticvision.uk
partner
2026-07-03T07:26:55.893Z
riverlearningtrust.org favicon

River Learning Trust

riverlearningtrust.org

70
EducationUnited KingdomlargeMEDIUM

River Learning Trust is a well-established multi-academy trust managing 30 schools and educational services in Oxfordshire and Swindon. The organization focuses on excellence in education, teacher training, and community engagement. The website reflects a professional and comprehensive digital presence with detailed information about schools, leadership, and services. The trust maintains active social media profiles and provides clear contact details, enhancing transparency and accessibility. Technically, the website uses a modern tech stack including jQuery, Google Tag Manager, Google Maps API, and a specialized school website platform by Cleverbox. It is mobile optimized and includes accessibility features, though some improvements could be made. Performance is moderate with good SEO and structured data implementation. Security posture is solid with HTTPS enforced and cookie consent implemented. However, explicit security headers and incident response information are absent, representing areas for improvement. The lack of WHOIS data limits domain registration analysis, but the website's professionalism and trust signals mitigate concerns. Overall, the site is a credible, secure, and user-friendly platform for the educational trust, supporting its mission and stakeholder engagement effectively.

70
68
2
98
62
80
100
educationmulti-academytrustschoolsteachertrainingoxfordshire+1 more
jQuery 2.1.3Google Tag ManagerGoogle TranslateGoogle Maps API+4
2026-07-02T07:25:36.253Z
kdmevents.co.uk favicon

KDM Events Ltd

kdmevents.co.uk

59
OtherUnited KingdommediumMEDIUM

KDM Events Ltd is a UK-based corporate events management company specializing in team building, conferences, and corporate event services. The company positions itself as an award-winning provider delivering services across the UK, targeting corporate clients seeking professional event planning and management. Their key offerings include team building activities, conference management, audio visual services, content and design, audience engagement, and awards ceremonies. The website reflects a medium-sized business with a professional and consistent brand presence. Technically, the website is built on WordPress and leverages a modern technology stack including jQuery, Google Analytics, Google Tag Manager, Google reCAPTCHA, New Relic monitoring, and CookieYes for consent management. The site is mobile optimized and demonstrates good SEO practices with structured data and meta tags. Performance is moderate with room for improvement in accessibility. From a security perspective, the site enforces HTTPS, uses reCAPTCHA to mitigate spam, and implements cookie consent mechanisms. However, it lacks visible security headers and does not publish a privacy policy or terms of service within the analyzed content. The WHOIS data is unavailable or invalid, raising concerns about domain registration legitimacy, although the website content itself appears professional and trustworthy. Overall, the website presents a solid business and technical foundation but should address privacy policy publication, improve security headers, and clarify domain registration details to enhance trust and compliance.

37
100
70
60
20
17
95
corporateeventsteambuildingconferencemanagementukbusinesseventplanning
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+9
2026-07-02T07:21:22.771Z
archsafety.com favicon

Arch Safety

archsafety.com

46
EnergyIrelandsmallHIGH

Arch Safety is a specialized training and site services provider focused on rope access, safety, and rescue training primarily serving the energy sector in Ireland. They hold leading positions in GWO and IRATA training, offering a range of accredited courses and site services tailored to industrial clients. The website reflects a professional and consistent brand image with clear navigation and relevant content for their target audience. Technically, the website uses modern frameworks such as Bootstrap 5 and jQuery, integrates Google Maps API, and employs secure HTTPS connections. The site is mobile optimized and performs moderately well, though accessibility features could be improved. No major technical issues or vulnerabilities were detected, but security headers are not visibly implemented. From a security perspective, the site enforces HTTPS and uses secure forms with CSRF tokens. However, it lacks visible security policies, incident response contacts, and cookie consent mechanisms, which are important for compliance and user trust. The absence of WHOIS data reduces domain trustworthiness, though the professional site and accreditations mitigate some concerns. Overall, Arch Safety presents a credible and professional online presence with room for improvement in privacy compliance and security transparency. The domain registration ambiguity warrants monitoring but does not currently indicate malicious intent.

70
-
-
70
53
-
2
safetytrainingropeaccessgwotrainingiratawindenergy+3 more
Bootstrap 5jQuery 3.7.1Google Maps APITypekit Fonts+1
2026-07-02T07:09:46.048Z
stream-measurement.com favicon

JWF Ltd

stream-measurement.com

54
EnergyUnited KingdommediumMEDIUM

Stream Measurement Ltd, operating under JWF Ltd, is a leading UK supplier specializing in flow meters and related instrumentation for energy and industrial sectors. The company offers a comprehensive range of products including gas, steam, water, and energy flow meters, alongside services such as repair, refurbishment, calibration, and commissioning. Their market position is strong within the UK, supported by partnerships with major instrumentation brands like ABB, Sensus, and Dresser Actaris. The website reflects a professional business model focused on supplying instrumentation and providing technical services to industrial clients. Technically, the website employs modern web technologies including Google Tag Manager, LiveChat, Mautic, and Hotjar for analytics and marketing, alongside a responsive design framework (Foundation). The site is mobile-optimized and includes accessibility features, though some security headers are not explicitly detected. Performance is moderate, with good SEO and structured data enhancing search visibility. From a security perspective, the site uses HTTPS and implements cookie consent mechanisms aligned with GDPR requirements. However, explicit security policies and incident response information are absent, and WHOIS data for the domain is unavailable, which raises concerns about domain transparency. No vulnerabilities or exposed sensitive data were detected in the content. Overall, the website presents a trustworthy and professional front for Stream Measurement Ltd, though improvements in domain registration transparency and security header implementation are recommended to enhance trust and security posture.

85
47
20
70
20
95
17
flowmetersenergymeasurementcalibrationinstrumentationuksupplier+2 more
Google Tag ManagerGoogle Maps APILiveChatMautic+5

Partner Domains:

jwfltd.com
partner
2026-07-01T07:24:43.684Z
readingspropertygroup.com favicon

Readings Property Group

readingspropertygroup.com

54
Real EstateUnited KingdomsmallMEDIUM

Readings Property Group is a small, established real estate agency based in Leicestershire, United Kingdom, specializing in residential and commercial property sales and lettings. Founded in 2010, the company positions itself as a local expert on the Leicestershire property market, offering services to buyers, renters, and sellers. The website reflects a professional business with clear branding and a focus on property services in the local area. The target audience includes individuals and businesses seeking property transactions in Leicestershire. Technically, the website is built on WordPress, leveraging modern frameworks such as Bootstrap and Font Awesome, and integrates several plugins tailored for real estate listings and customer reviews. Hosting and DNS services are managed via Cloudflare, providing a reliable infrastructure. The site is mobile-optimized and includes SEO best practices, though accessibility features are basic. Analytics and marketing tools such as Google Analytics, Google Tag Manager, and Facebook SDK are implemented, alongside a cookie consent mechanism via CookieYes. From a security perspective, the site enforces HTTPS and uses Cloudflare DNS, but lacks explicit security headers and publicly available security or incident response policies. Forms include reCAPTCHA to mitigate spam. No critical vulnerabilities or exposed sensitive data were detected. WHOIS data confirms domain legitimacy with consistent registration details and appropriate domain age. Overall, the website demonstrates a solid business presence with good technical implementation and moderate security posture. However, improvements in privacy compliance documentation and security policy transparency are recommended to enhance trust and regulatory adherence.

-
70
65
100
15
100
2
realestatelettingspropertyleicestershireestateagents+2 more
WordPressBootstrap 5.1.3Font Awesome 5 and 6jQuery 3.5.1+7
2026-07-01T07:24:12.144Z
C

Coercive Systems Limited

coercive.com

50
TechnologyUnited KingdomsmallMEDIUM

Coercive Systems Limited is a UK-based company specializing in the design, manufacture, and distribution of advanced electro-optical components, thrusters, brushless DC motors, specialized sensors, generators, servo components, and cryogenic cooling engines. Serving industrial, marine, scientific, aerospace, and defense markets worldwide, the company has over 30 years of experience and a niche market position with international reach. The website reflects a professional business presence with clear contact information and product offerings but lacks some modern digital maturity features such as privacy policies and security disclosures. Technically, the website uses older but stable technologies including Bootstrap 3.1.1, jQuery, Owl Carousel, and Google Maps API. The site is moderately optimized for performance and mobile use but could benefit from improved accessibility and SEO practices. No CMS or hosting provider details were identified. Security posture is weak due to missing HTTPS verification, lack of security headers, and absence of privacy and cookie policies. From a security perspective, the site shows no signs of WAF or blocking mechanisms and is fully accessible. However, the WHOIS data is missing or indicates the domain is unregistered or expired, which is a significant concern for legitimacy and trust. No contact emails or incident response information are provided, and no vulnerability disclosure or security policies are found. The presence of an Intertek certification logo adds some trustworthiness. Overall, the site is functional and professional but requires urgent improvements in security, privacy compliance, and domain registration legitimacy to enhance trust and reduce risk.

15
50
2
70
47
50
100
electro-opticalthrustersbrushlessmotorscryogeniccoolingindustrial+4 more
Bootstrap 3.1.1jQueryOwl CarouselGoogle Maps API+1
2026-07-01T07:22:53.287Z
kgjgroup.co.uk favicon

NFP

kgjgroup.co.uk

68
FinanceUnited KingdomlargeMEDIUM

NFP UK Limited, a subsidiary of AON, operates as a leading global insurance and employee benefits consultancy. The company offers a broad range of services including commercial insurance, employee benefits consulting, financial planning, and human capital solutions. Their market position is strong, supported by the backing of the global AON brand, and they target businesses and individuals seeking comprehensive insurance and financial services. The website reflects a professional and well-structured digital presence, indicating a mature technical infrastructure with modern technologies such as jQuery, Bootstrap, and Google Tag Manager integrated for analytics and marketing. From a security perspective, the website enforces HTTPS and employs multiple security best practices, although explicit security headers could be more visible. The presence of multiple third-party analytics and marketing tools suggests extensive user tracking, balanced by clear privacy and cookie policies with consent mechanisms, indicating good privacy compliance. However, the WHOIS data is unavailable due to domain naming rules errors, which raises concerns about domain registration legitimacy despite the strong business branding and presence. Overall, the website is professionally designed, mobile-optimized, and accessible, with a high level of content quality and user experience. The main risk lies in the lack of WHOIS transparency, which should be addressed to improve trustworthiness. Strategic recommendations include enhancing security header implementation, publishing a vulnerability disclosure policy, and improving incident response contact visibility to strengthen the security posture further.

90
58
17
85
44
70
100
insuranceemployeebenefitsfinancialplanninghumancapitalrisksolutions+5 more
jQuery 3.6.4Google Tag ManagerFont Awesome 6 ProBootstrap (implied by classes)+2

Partner Domains:

aon.com
parent
2026-06-30T07:18:21.605Z
E

Eco Sustainable Solutions Ltd

thisiseco.co.uk

58
EnergyUnited KingdommediumMEDIUM

Eco Sustainable Solutions Ltd is a well-established company founded in 1995, specializing in sustainable waste management and renewable energy solutions across Southern England. The company focuses on transforming waste into valuable resources through various recycling services and green energy production, positioning itself as a regional leader in the energy sector. Their website reflects a professional and environmentally conscious brand with clear messaging and strong trust indicators such as environmental impact statistics and project involvement with notable initiatives like The Eden Project and a solar farm. Technically, the website is built on WordPress using Elementor and Gravity Forms, integrating modern analytics and tracking tools such as Google Analytics, Facebook Pixel, and Hotjar. The site is mobile-optimized, accessible, and SEO-friendly, though performance is moderate. Security posture is good with HTTPS enforced and CAPTCHA on forms, but lacks some security headers and formal privacy/cookie policies. The absence of WHOIS data due to a domain naming rules error reduces domain registration trustworthiness, though the website content and business information strongly indicate legitimacy. No WAF or blocking mechanisms were detected, allowing full content access and analysis. Overall, the website demonstrates a mature digital presence with room for improvement in privacy compliance and security best practices. Strategic recommendations include publishing comprehensive privacy and cookie policies, implementing security headers, and verifying domain registration details to enhance trust and compliance.

37
65
60
100
73
45
2
sustainabilityrecyclingrenewableenergywastemanagementecosolutions+1 more
WordPressElementorGravity FormsGoogle Maps API+3

Partner Domains:

eco-landscaping.co.uk
partner
2026-06-29T07:26:48.594Z
brenhaul.co.uk favicon

Brenhaul

brenhaul.co.uk

52
TransportationUnited KingdomsmallMEDIUM

Brenhaul is a UK-based commercial vehicle servicing company specializing in heavy goods vehicles (HGV) and public service vehicles (PSV). Established in 1998, the company offers a range of services including Pre-MOT preparation, maintenance contracts, servicing repairs, and 24-7 breakdown and recovery. The website positions Brenhaul as a niche specialist serving commercial vehicle operators and fleet managers, with a focus on quality and reliability. The presence of customer reviews and partner logos adds to its trustworthiness. Technically, the website is built on WordPress and incorporates modern web technologies such as Font Awesome icons, Google Maps API, and a responsive design. While the site performs moderately well and is mobile-optimized, it lacks advanced SEO and accessibility features. The absence of cookie consent mechanisms and limited privacy compliance features indicate room for improvement in regulatory adherence. From a security perspective, the site uses HTTPS and secure forms but lacks important security headers like Content-Security-Policy and HSTS. No incident response or security policy information is provided, which could be a concern for compliance and trust. The WHOIS data shows a consistent and mature domain registration, supporting the legitimacy of the business. Overall, Brenhaul's website is functional and professional but would benefit from enhanced security practices, privacy compliance improvements, and more comprehensive business and security policy disclosures to strengthen trust and regulatory adherence.

100
55
65
52
15
2
53
commercialservicinghgvpsvvehiclemaintenancebreakdownrecovery+1 more
WordPressPHPJavaScriptFont Awesome+2
2026-06-29T07:18:56.556Z
V

Vowles Parks

vowlesparks.co.uk

50
Real EstateUnited KingdomsmallMEDIUM

Vowles Parks is a family-owned business operating six residential and holiday parks in the South West of England and South Wales, targeting retired and semi-retired individuals as well as families seeking holiday retreats. The company offers luxury park home living with a focus on peaceful, affordable, and high-specification homes. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website is built on WordPress with modern technologies including jQuery, Google Fonts, Google Maps API, and HubSpot marketing and analytics tools. Cookie consent is managed via Cookiebot, ensuring compliance with cookie regulations. The site is mobile optimized and SEO friendly, though accessibility features are basic. From a security perspective, HTTPS is enforced, and no critical vulnerabilities or exposed sensitive data were detected. However, security headers are not explicitly present, and there is no visible security policy or incident response information. The domain registration is consistent with the business claims, showing a long-established presence since 2008. Overall, the website demonstrates a solid security posture and good privacy compliance, though improvements could be made by publishing explicit security policies and enhancing security headers. The business credibility is high with clear contact information and trust indicators such as testimonials and professional marketing tools.

55
65
37
20
30
17
95
realestateholidayparksresidentialparksfamilyownedpetfriendly
WordPressjQueryGoogle FontsGoogle Maps API+3
2026-06-29T07:05:05.507Z
eicc.co.uk favicon

EICC

eicc.co.uk

61
HospitalityUnited KingdommediumMEDIUM

The Edinburgh International Conference Centre (EICC) is a well-established multi-purpose venue located in central Edinburgh, Scotland, specializing in hosting conferences, exhibitions, and large-scale events. The website presents a professional and comprehensive digital presence, emphasizing sustainability, inclusivity, and a strong commitment to delivering impactful events. The venue is positioned as a leading player in the hospitality and events sector within the UK, supported by multiple certifications and awards that reinforce its credibility and market standing. The target audience includes event organizers, delegates, and visitors seeking a high-quality venue with modern facilities and sustainable practices. Technically, the website employs modern web technologies including Google Tag Manager, Google Analytics, Facebook Pixel, and Google Maps API, alongside a responsive design optimized for mobile devices. The site demonstrates good SEO and accessibility practices, with clear navigation and rich multimedia content enhancing user experience. Security posture is strong with HTTPS enforced and no exposed sensitive data, although some security headers could be improved for enhanced protection. From a security and compliance perspective, the site lacks explicit security policy or incident response contact information, which could be areas for improvement. The WHOIS data for the domain is unavailable due to a domain naming rules violation error, likely caused by querying the subdomain 'www.eicc.co.uk' instead of the registered domain 'eicc.co.uk'. This absence of WHOIS data reduces the ability to fully verify domain registration legitimacy but does not detract from the professional nature of the website content. Overall, the EICC website is a high-quality, trustworthy platform that effectively supports the business objectives of the venue. Strategic recommendations include enhancing security headers, publishing clear security and incident response policies, and …

100
70
65
74
12
45
35
eiccedinburghconferencecentreeventsvenuesustainability+3 more
Google Tag ManagerGoogle Analytics (gtag.js)Facebook PixelGoogle Maps API+2
2026-06-29T07:00:41.597Z
barnardos.org.uk favicon

Barnardo's

barnardos.org.uk

65
Non-profitUnited KingdomlargeMEDIUM

Barnardo's is a well-established UK children's charity dedicated to supporting children and young people to be safer, happier, and healthier. The organization operates a comprehensive website offering resources, support services, and multiple engagement channels including donations, volunteering, and campaigning. The site is professionally designed with clear navigation and strong branding consistency, targeting a broad audience including young people, parents, carers, and donors. Technically, the website leverages Drupal CMS, integrates Google Maps API for location services, and uses performance monitoring tools such as SpeedCurve LUX and Cloudflare Insights, indicating a mature digital infrastructure. Security posture is strong with HTTPS enforced, multiple security headers present, and no visible vulnerabilities or exposed sensitive data. Privacy compliance is robust, featuring clear privacy and cookie policies with consent mechanisms aligned with GDPR requirements. Although WHOIS data for the 'www.barnardos.org.uk' subdomain is unavailable due to domain naming rules, the overall legitimacy and trustworthiness of the site are high based on content quality and trust indicators. Strategic recommendations include publishing a dedicated security policy, incident response contacts, and a vulnerability disclosure program to further enhance transparency and security readiness.

80
44
100
70
2
50
83
charitychildrennon-profitsupportdonation+4 more
Google Maps APIDrupal CMSSpeedCurve LUXCloudflare Insights

Partner Domains:

donate.barnardos.org.uk
partner
shop.barnardos.org.uk
partner

+1 more partners

2026-06-27T07:23:37.367Z
C

Carlsons Solicitors

carlsonssolicitors.com

66
Real EstateUnited KingdomsmallMEDIUM

Carlsons Solicitors is a full-service law firm based in London, serving both national and international clients. The firm is recognized in The Legal 500 UK 2026, indicating a strong market position and reputable service offering. Their key services include family law, residential conveyancing, probate, debt recovery, immigration, and dispute resolution. The website targets individuals and businesses seeking professional legal assistance, emphasizing client relationships and personalized service. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as Google Analytics, Google Tag Manager, and the Plyr video player. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, typical for a CMS-based site with multimedia content. From a security perspective, the site enforces HTTPS and implements a cookie consent banner, but lacks advanced security headers such as HSTS and Content-Security-Policy. No explicit security or incident response policies are published, which could be improved to enhance trust and compliance. The WHOIS data is unavailable, which reduces transparency and trustworthiness, though the professional content and client testimonials mitigate some concerns. Overall, the website presents a professional and trustworthy image suitable for a law firm, but could benefit from enhanced security practices and clearer privacy documentation to improve compliance and user trust.

80
54
100
75
17
35
95
lawfirmlegalservicesfamilylawconveyancingdisputeresolution+2 more
Squarespace CMSGoogle AnalyticsGoogle Tag ManagerjQuery+2
2026-06-27T07:09:03.204Z
H

Haygrove Limited

haygrove.com

66
ManufacturingUnited KingdommediumMEDIUM

Haygrove Limited is a UK-based company specializing in the design, manufacture, and supply of commercial polytunnels, substrate gutter systems, and associated growing technologies. With over 30 years of experience, the company also operates farms growing berries, cherries, and organic produce across multiple countries. Their market position is that of an established international supplier and grower, serving commercial agricultural clients globally. The website reflects a professional business with clear branding, comprehensive product offerings, and a focus on sustainability and innovation. Technically, the website employs a modern technology stack including jQuery, Foundation CSS framework, Font Awesome, and integrates multiple analytics and tracking tools such as Google Analytics, Hotjar, and Lead Forensics. The site is mobile-optimized with good SEO practices and a cookie consent mechanism, indicating a mature digital presence. However, some accessibility features could be improved, and security headers are not detected. From a security perspective, the site enforces HTTPS and uses cookie consent, but lacks explicit security policies or incident response information. No critical vulnerabilities or exposed sensitive data were found in the HTML content. The absence of WHOIS domain registration data is a notable concern, potentially indicating domain registration issues, which impacts the overall trustworthiness assessment. Overall, Haygrove's website is professional and business-focused with good content quality and privacy compliance. The main risk lies in the missing WHOIS data, which should be investigated further to confirm domain legitimacy and ownership. Enhancing security headers and publishing security policies would strengthen their security posture and trust with visitors.

32
85
100
85
65
83
2
agriculturepolytunnelsberriescherriescommercialgrowing+3 more
jQueryFoundation CSS frameworkFont AwesomeGoogle Analytics+6

Partner Domains:

gardentunnels.co.uk
partner
haygrove-evolution.com
partner
2026-06-26T07:17:00.439Z
simply2let.com favicon

Simply 2 Let Limited

simply2let.com

52
Real EstateUnited KingdomsmallMEDIUM

Simply 2 Let Limited is a small, established property letting and management company based in Great Yarmouth, UK. The company provides dedicated services to landlords and tenants, focusing on local lettings and property management. Their website reflects a professional and consistent brand image with clear contact details and service descriptions. The business appears to have been founded around 2017, aligning with the website's published content dates. Technically, the website is built on WordPress using common plugins such as Contact Form 7 and Cookie Consent, with integration of Google Maps API for location services. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features are basic. Performance is moderate with no major technical issues detected. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism, but lacks important security headers and explicit security or incident response policies. No vulnerabilities or exposed sensitive data were found in the content. The absence of WHOIS registration data is a significant concern, impacting the overall trustworthiness of the domain. Overall, the website is functional and professional but would benefit from improved security practices and verification of domain registration to enhance trust and compliance.

20
65
2
60
37
60
100
lettingpropertymanagementgreatyarmouthrealestatelandlords+1 more
jQueryGoogle Maps APIContact Form 7Cookie Consent plugin+1
2026-06-26T07:12:38.434Z
kychamber.com favicon

Kentucky Chamber of Commerce

kychamber.com

61
GovernmentUnited StateslargeMEDIUM

The Kentucky Chamber of Commerce is a prominent statewide business advocacy organization dedicated to uniting businesses and advancing economic and policy interests in Kentucky. The website serves as a comprehensive portal for policy issues, events, membership services, and workforce solutions, targeting businesses and professionals within the state. The organization positions itself as a key influencer in Kentucky's business environment with a large membership base and multiple strategic partnerships. Technically, the website is built on Drupal 10, leveraging modern web technologies including Google Analytics, Facebook Pixel, and Google Tag Manager for analytics and marketing. The site is well-structured, mobile-optimized, and provides a professional user experience with clear navigation and rich content. However, some technical improvements could enhance security and privacy compliance, such as implementing cookie consent mechanisms and security headers. From a security perspective, the site uses HTTPS with good SSL configuration and does not expose sensitive data in the HTML. While no critical vulnerabilities were detected, the absence of certain security headers and lack of published incident response or vulnerability disclosure policies indicate room for improvement. The WHOIS data is incomplete, lacking registrar and registrant details, which slightly impacts trust but the website content and branding strongly support legitimacy. Overall, the Kentucky Chamber of Commerce website is a professional, content-rich platform with a solid technical foundation and good business credibility. Strategic enhancements in privacy compliance and security policies would further strengthen its security posture and user trust.

80
100
42
80
53
50
2
businessadvocacymembershipeventskentucky+1 more
Drupal 10Google Tag ManagerGoogle AnalyticsFacebook Pixel+3

Partner Domains:

kychamberbottomline.com
partner
bestplacestoworkkentucky.com
partner

+3 more partners

2026-06-25T07:09:00.536Z
harrisdaf.com favicon

Harris DAF Grays

harrisdaf.com

46
TransportationUnited KingdommediumHIGH

Harris DAF Grays is a well-established UK-based dealership group specializing in DAF trucks, offering new and used truck sales, servicing, and parts supply. The company operates multiple locations across Essex, Hertfordshire, and Buckinghamshire, providing comprehensive transport solutions including finance and leasing options. Their affiliation with PACCAR and multiple dealership sites positions them as a significant player in the UK truck dealership market. The website reflects a professional business presence with clear service offerings and contact information. Technically, the site employs modern web technologies such as Google Maps API, jQuery, and UIkit, ensuring a responsive and user-friendly experience. Security measures include HTTPS enforcement and use of Google reCAPTCHA, although some security headers and explicit policies are absent. Privacy and cookie policies are present with consent mechanisms, indicating good compliance with GDPR. However, the absence of WHOIS registration data raises concerns about domain legitimacy, which should be further investigated. Overall, the website is functional, professional, and trustworthy from a user perspective but could improve transparency in domain registration and security policies.

47
60
60
20
20
2
83
trucksalestruckservicingdaftruckstruckpartstransportation+2 more
Google Maps APIjQuery 3.7.1UIkitGoogle Fonts+3

Partner Domains:

www.harrisdafhighwycombe.com
subsidiary
www.harrisdaflv.com
subsidiary

+1 more partners

2026-06-25T07:01:28.880Z
visitdartmoor.co.uk favicon

Visit Dartmoor

visitdartmoor.co.uk

64
HospitalityUnited KingdomsmallMEDIUM

Visit Dartmoor is a well-established regional tourism website founded in 2006, providing comprehensive information on accommodation, food, attractions, and activities in the Dartmoor area of the United Kingdom. The website targets tourists and visitors seeking to explore Dartmoor, offering detailed guides, booking options, and an online shop for related products. Its market position is that of a trusted local tourism portal with consistent branding and a professional online presence. Technically, the website is built on WordPress using popular plugins such as WooCommerce for e-commerce, Elementor for page building, and Yoast SEO for search engine optimization. It integrates Google Analytics and Google Maps APIs to enhance user experience and track visitor data. The site demonstrates good mobile optimization and moderate performance, with room for improvement in accessibility features. From a security perspective, the website employs HTTPS and Google reCAPTCHA to protect forms, with no visible vulnerabilities or exposed sensitive data. However, it lacks some recommended security headers and does not publish a formal security policy or incident response contacts. Privacy and cookie policies are present and GDPR compliant, reflecting a basic but adequate privacy posture. Overall, Visit Dartmoor presents a low-risk profile with a strong business credibility and good technical implementation. Strategic improvements in security headers, incident response readiness, and accessibility compliance would further enhance its security posture and user trust.

65
70
37
100
-
22
70
tourismtravelaccommodationdartmoorhospitality+3 more
WordPressWooCommerceElementorYoast SEO+3
2026-06-24T07:25:46.560Z
instrument-pd.co.uk favicon

Instrument Product Development Ltd. t/a Instrument Industries

instrument-pd.co.uk

52
TechnologyUnited KingdomsmallMEDIUM

Instrument Product Development Ltd., trading as Instrument Industries, is a UK-based small business specializing in integrated product development services including industrial design, engineering, manufacturing, and distribution. Founded in 2013, the company emphasizes sustainable and transparent supply chains and serves clients worldwide. The website presents a professional image with clear business information and contact details, supporting its market position as a specialist product development firm. Technically, the website is built on the Webflow platform, leveraging modern web technologies such as Google Fonts, Google Maps API, and Mailchimp for email marketing. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO. Security posture is good with HTTPS enforced and no tracking scripts, but lacks advanced security headers and formal policies. The security evaluation shows a respectable baseline with secure form handling and no visible vulnerabilities. However, the absence of privacy and cookie policies, as well as incident response information, indicates compliance gaps. The WHOIS data for the .co.uk domain is unavailable due to domain registration issues, but the company uses the instrument.industries domain actively, which aligns with the business identity. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance and security best practices to strengthen user trust and regulatory adherence.

30
35
2
50
54
70
100
productdevelopmentindustrialdesignengineeringmanufacturinguk+3 more
WebflowGoogle FontsGoogle Maps APIjQuery 3.5.1+1
2026-06-24T07:23:57.524Z
littlecroftproperties.co.uk favicon

Littlecroft Properties Limited

littlecroftproperties.co.uk

55
Real EstateUnited KingdomsmallMEDIUM

Littlecroft Properties Limited is a UK-based real estate company specializing in residential, retail, office, and development properties primarily in East London and Essex. Established since 1975, the company serves property buyers, renters, investors, and developers with a focus on local market expertise. The website reflects a professional and consistent brand presence with clear contact information and comprehensive privacy and cookie policies, indicating a commitment to user privacy and regulatory compliance. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Tag Manager, and various UI plugins. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. Analytics are implemented via Google Tag Manager, and cookie consent mechanisms are in place, supporting GDPR compliance. From a security perspective, the site uses HTTPS and secure login forms but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious domains were detected, but improvements in security headers and transparency would enhance the security posture. Overall, the website is trustworthy and professionally maintained, though the WHOIS data query was performed incorrectly on a subdomain, resulting in missing domain registration details. This discrepancy slightly reduces trust but does not indicate malicious intent. Strategic recommendations include enhancing security headers, publishing security policies, and verifying WHOIS data for domain legitimacy.

70
70
100
27
15
68
17
realestatepropertyresidentialretailoffices+4 more
WordPressjQueryGoogle Tag ManagerGoogle Maps API+6
2026-06-24T07:19:04.572Z