Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

157332
Websites
130
Industries
113
Countries
52
Avg Score
Page 306 of 1064|Showing 15251-15300 of 53176
paulus-catering.cz favicon

PAULUS Catering

paulus-catering.cz

45
HospitalityCzech RepublicsmallHIGH

PAULUS Catering is a professional catering company based in Olomouc, Czech Republic, specializing in event catering for celebrations, weddings, corporate events, and special dietary needs. Led by chef Roman Paulus, the company emphasizes quality, fresh ingredients, and personalized service. Their offerings include venue rental and specialized cuisine options such as vegetarian, vegan, gluten-free, and low carb menus. The website reflects a well-established local business with a clear focus on customer experience and professionalism. Technically, the website uses a custom PHP-based CMS with modern JavaScript libraries including jQuery, Google Tag Manager, and Google reCAPTCHA for spam protection. The site is mobile-optimized, has good SEO practices, and includes cookie consent mechanisms compliant with GDPR. However, some security headers are missing, and no explicit security or incident response policies are published. Security posture is solid with HTTPS enforced and spam protection on forms, but could be improved with additional HTTP security headers and a published vulnerability disclosure policy. The absence of WHOIS data limits domain legitimacy verification, but the website content and contact information appear trustworthy and professional. Overall, PAULUS Catering presents a credible and professional online presence suitable for its business sector, with moderate technical sophistication and good privacy compliance. Strategic improvements in security transparency and domain registration data would enhance trust further.

20
25
2
65
65
85
20
cateringolomouceventsweddingscorporatecatering+4 more
jQueryGoogle reCAPTCHAGoogle Tag Manager

Partner Domains:

www.bistro-paulus.cz
partner
www.lobster-restaurant.cz
partner

+2 more partners

2025-10-17T16:47:41.085Z
sekogroup.com favicon

SEKO Group

sekogroup.com

48
ManufacturingCzech RepubliclargeHIGH

SEKO Group is a leading manufacturing company specializing in high-precision components for aerospace engines, steam turbines, and water turbines, with additional production of stamping tools and pressings. The company operates multiple production facilities across the Czech Republic, Brazil, and India, serving industrial clients primarily in the aerospace and energy sectors. Their business model focuses on B2B manufacturing with a strong emphasis on quality and certification compliance, positioning them as a key supplier in their markets. Technically, the website is built on WordPress using the Jupiter theme and WPBakery page builder, integrating modern tracking and marketing tools such as Google Tag Manager and Facebook Pixel. The site is well-optimized for mobile devices and demonstrates good SEO and accessibility practices, although some security headers could be improved. From a security perspective, the site enforces HTTPS and uses reCAPTCHA v3 for form protection, alongside GDPR-compliant cookie consent mechanisms. However, it lacks visible security policies and incident response contact information, which could be enhanced to improve trust and compliance. Overall, the website is professional, content-rich, and compliant with privacy regulations, but the absence of WHOIS data and some security documentation slightly reduce the trust score. Strategic improvements in security transparency and WHOIS data availability would strengthen the company's digital trustworthiness.

15
50
2
85
72
60
20
manufacturingaerospaceenergycomponentsindustrial+3 more
WordPressWPBakery Page BuilderJupiter ThemeGoogle Tag Manager+2

Partner Domains:

seko-do-brasil.com
subsidiary
sekoshivamengitech.com
subsidiary
2025-10-17T16:28:06.081Z
pobytyprodeti.cz favicon

Pobyty pro děti | Školy v přírodě, dětské tábory, sportovní soustředění – Ubytování pro školy a rodiny s dětmi – školy v přírodě, letní tábory, sportovní kempy i firemní akce v krásné přírodě jižních Čech.

pobytyprodeti.cz

10
HospitalityCzech RepublicsmallCRITICAL

The website 'pobytyprodeti.cz' serves as a hospitality platform offering accommodation and organized stays such as schools in nature, children's camps, sports training camps, and corporate events primarily targeting schools, families with children, and corporate groups in the South Bohemia region of the Czech Republic. The business appears to be a small regional service provider established since 2009, with a clear focus on family and educational hospitality services. Technically, the website is built on WordPress using the Elementor page builder and Astra theme, hosted by WEDOS, a Czech hosting provider. It integrates modern web technologies including Google Tag Manager and CookieYes for cookie consent management. The site is mobile-optimized and demonstrates good SEO and accessibility basics, though some improvements in accessibility and security headers are recommended. From a security perspective, the site enforces HTTPS and provides a detailed cookie consent mechanism, reflecting good privacy compliance practices. However, it lacks explicit privacy and security policies, incident response contacts, and security headers, which are areas for improvement. No vulnerabilities or suspicious elements were detected in the visible content. Overall, the website presents a professional and trustworthy front for its hospitality services with moderate technical maturity and privacy compliance. Strategic enhancements in security policies, contact transparency, and security headers would further strengthen its security posture and user trust.

-
-
-
-
-
-
-
hospitalitychildrencampsschoolsinnaturesummercampsfamilyaccommodation+2 more
WordPressElementorAstra ThemejQuery+2
2025-10-17T16:26:50.801Z
ukas.com favicon

The United Kingdom Accreditation Service

ukas.com

11
GovernmentUnited KingdommediumCRITICAL

The United Kingdom Accreditation Service (UKAS) operates as the national accreditation body for the UK, appointed by the government to assess and accredit organizations providing certification, testing, inspection, and calibration services. The website reflects a mature and professional digital presence with comprehensive content targeting businesses, government entities, and professional bodies seeking accreditation services. The site is well-branded and consistent with UK government standards, offering clear navigation and extensive information about accreditation processes and standards. Technically, the website is built on WordPress with modern SEO and analytics tools such as Yoast SEO, Google Tag Manager, and New Relic for performance monitoring. The site is optimized for mobile and accessibility, with strong security practices including HTTPS enforcement and security headers. Cookie consent and privacy policies are implemented in compliance with GDPR. Security posture is robust with no evident vulnerabilities or exposed sensitive data. However, the absence of public vulnerability disclosure and incident response contacts suggests room for improvement in transparency and security communication. The WHOIS data is notably missing, which is unusual for a government-affiliated domain and slightly reduces trust from a domain registration perspective. Overall, UKAS presents a trustworthy and authoritative online presence with strong business credibility and technical maturity. Strategic recommendations include publishing a vulnerability disclosure policy, incident response contacts, and clarifying domain registration details to enhance trust further.

-
-
-
-
-
-
-
accreditationcertificationinspectiontestingcalibration+5 more
WordPressYoast SEOjQueryGoogle Tag Manager+1

Partner Domains:

certcheck.ukas.com
service
ukas.talosats-careers.com
partner
2025-10-17T16:26:40.775Z
outfindo.cz favicon

Outfindo

outfindo.cz

71
TechnologyN/asmallMEDIUM

Outfindo is a technology company specializing in AI-driven guided selling software and product data enrichment solutions aimed at enhancing the online shopping experience for e-commerce businesses. Their platform leverages proprietary AI agents to analyze customer behavior and automate product data management, enabling retailers to provide tailored shopping guidance that improves conversion rates. The company positions itself as a niche provider in the e-commerce technology space, offering SaaS solutions with a focus on seamless integration and user-friendly setup. Technically, the website is built on the Webflow CMS platform and integrates multiple modern marketing and analytics tools including HubSpot, Facebook Pixel, Microsoft Clarity, and Apollo.io. The site demonstrates excellent design quality, mobile optimization, and SEO practices, reflecting a mature digital infrastructure. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. From a security perspective, the site enforces HTTPS and employs cookie consent but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected in the content. The absence of WHOIS data for the domain is a notable anomaly, reducing transparency but not necessarily indicating malicious intent given the professional nature of the site. Overall, Outfindo presents a credible and professional online presence with strong business and technical foundations. Strategic improvements in security policy transparency and domain registration disclosure would enhance trust and compliance posture.

60
68
17
85
75
80
100
aiguidedsellinge-commerceproductdataenrichmentsaas+4 more
Google Tag ManagerHubSpot AnalyticsFacebook PixelMicrosoft Clarity+4
2025-10-17T16:26:35.766Z
queue-it.net favicon

Queue-it

queue-it.net

76
TechnologyDenmarkmediumLOW

Queue-it is a Denmark-based technology company founded in 2010 specializing in virtual waiting room solutions designed to manage peak online traffic and prevent website crashes and bot abuse. The company offers a SaaS platform that enables businesses to control traffic flow during high-demand events, ensuring fair and reliable user experiences. With subsidiaries in the US, Australia, and South Korea, Queue-it serves a global market including ecommerce, ticketing, public sector, education, and financial services. The website reflects a mature digital presence with comprehensive product information, customer testimonials, and strong branding consistency. Technically, the website employs modern web technologies such as Google Tag Manager, jQuery, Bootstrap, and service workers, hosted on AWS infrastructure. It demonstrates good performance, mobile optimization, and SEO practices. Privacy and cookie policies are clearly presented with consent mechanisms, supporting GDPR compliance. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though security headers could be enhanced. Overall, Queue-it's security posture is robust with good privacy compliance and transparent business information. The domain registration is consistent with the company's claims, showing a trustworthy and established online presence. No WAF or blocking mechanisms interfere with content access, and no adult or questionable content is present. Strategic recommendations include improving security headers, publishing a security.txt file for vulnerability disclosure, and enhancing incident response contact visibility to further strengthen trust and compliance.

65
95
10
85
77
85
100
virtualwaitingroomtrafficmanagementbotprotectionsaashightraffic+5 more
Google Tag ManagerjQueryBootstrapLazysizes+1
2025-10-17T16:26:20.732Z
c212.net favicon

Cision

c212.net

67
MediaN/aenterpriseMEDIUM

Cision operates as a global provider of cloud-based communications and PR software services, targeting professionals in marketing, media relations, and content marketing. The company offers a suite of services including media monitoring, media list building, distribution, and analysis, positioning itself as an established player in the media industry. The website content is professional but limited in depth on the privacy policy page, with no direct contact information or detailed security policies presented. Technically, the website employs modern tracking and marketing technologies such as Google Tag Manager, OneTrust for cookie consent, and third-party attribution tools. The site is accessible without any WAF or blocking mechanisms, but lacks explicit security headers and detailed accessibility features. Mobile optimization and SEO are basic but functional. From a security perspective, the site uses HTTPS and cookie consent mechanisms, but the absence of WHOIS data and registrant information raises concerns about domain registration transparency. No incident response or security contact details are provided, limiting the ability to assess compliance fully. Overall, the security posture is moderate but could be improved with better header implementation and transparency. The overall risk is moderate with recommendations to enhance security headers, provide clear contact information for security incidents, improve accessibility, and clarify domain registration details to increase trustworthiness.

65
43
17
85
75
85
100
privacypolicycookieconsentmediamonitoringprsoftwaremarketing+1 more
Google Tag ManagerOneTrust Cookie ConsentQualifiedG2 Crowd Attribution Tracking+1
2025-10-17T16:25:05.308Z
M

MJH Life Sciences

urologytimes.com

62
HealthcareUnited StatesmediumMEDIUM

Urology Times is a well-established healthcare media publication specializing in urology news, clinical insights, and educational content for urologists and allied health professionals. The website is operated by MJH Life Sciences, a recognized entity in medical publishing. The platform offers a broad range of services including news articles, conference coverage, podcasts, and continuing medical education resources, positioning itself as a leading resource in its niche. The target audience is primarily healthcare professionals specializing in urology, and the content is professionally curated to meet their informational needs. Technically, the website employs a modern technology stack including Astro framework, Sanity CMS, and various analytics and advertising tools such as Segment Analytics and Google Tag Manager. The site is optimized for performance and mobile responsiveness, with good SEO and accessibility practices in place. Security measures include HTTPS enforcement and standard security headers, contributing to a strong security posture. While the WHOIS data is not publicly available, indicating privacy protection, the website's content and business information are consistent and professional, supporting its legitimacy. Privacy and cookie policies are comprehensive and GDPR compliant, though explicit security policies and incident response contacts are not publicly disclosed. Overall, the site demonstrates a mature digital presence with a strong focus on content quality and user experience. Strategic recommendations include publishing a dedicated security policy, establishing a vulnerability disclosure program, and enhancing incident response transparency to further strengthen trust and compliance. Continued monitoring of third-party scripts and regular security audits are advised to maintain the robust security posture.

30
53
17
70
62
80
100
healthcareurologymedicalnewsmediaeducation+1 more
JavaScriptSegment AnalyticsGoogle Tag ManagerBrightcove Video Player+2

Partner Domains:

jobs.modernmedicine.com
partner
www.medicalworldnews.com
partner
2025-10-17T16:24:45.136Z
C

Contemporary OB/GYN

contemporaryobgyn.net

63
HealthcareUnited StatesmediumMEDIUM

Contemporary OB/GYN is a specialized healthcare media platform focused on delivering clinical updates, expert commentary, and educational resources in obstetrics and gynecology. The website serves healthcare professionals with a comprehensive range of content including news, podcasts, conference coverage, and continuing medical education. The platform demonstrates a mature market position within the healthcare media niche, supported by professional design and consistent branding. Technically, the website employs modern web technologies such as Astro framework, Sanity CMS, and integrates advanced analytics and consent management tools like Segment Analytics and OneTrust. The site is mobile-optimized, accessible, and SEO-friendly, ensuring a positive user experience across devices. From a security perspective, the site enforces HTTPS, implements key security headers, and uses cookie consent mechanisms aligned with GDPR compliance. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of a public security policy or incident response contact suggests room for improvement in transparency and readiness. Overall, Contemporary OB/GYN presents a low-risk profile with strong business credibility and technical maturity. Strategic enhancements in security policy publication and incident response communication would further strengthen trust and compliance.

30
53
17
70
62
85
100
healthcaremedicalnewsobstetricsgynecologyeducation+1 more
JavaScriptSegment AnalyticsGoogle Tag ManagerOneTrust Cookie Consent+2

Partner Domains:

www.medicalworldnews.com
partner
mjhlifesciences.com
partner
2025-10-17T16:24:40.126Z
M

MJH Life Sciences

hcplive.com

68
HealthcareUnited StatesmediumMEDIUM

HCPLive is a specialized clinical news and information portal serving physicians and healthcare professionals with disease-specific resources, conference coverage, and interviews. Operated by MJH Life Sciences, the website positions itself as a trusted source of medical news and education. The business model centers on content publishing targeted at healthcare providers, with a medium-sized organizational footprint and a founding date of 2008. The site demonstrates consistent branding and professional content quality, appealing to a niche medical audience. Technically, the website employs modern analytics and consent management tools such as Google Tag Manager, Segment Analytics, and OneTrust, indicating a mature digital infrastructure. The site is well-optimized for mobile devices and SEO, with good performance and accessibility at a basic level. Security best practices are observed with HTTPS enforcement and security headers, though explicit security policies and incident response details are absent. From a security perspective, the site shows a solid posture with no evident vulnerabilities or exposed sensitive data. However, the absence of a vulnerability disclosure program and security.txt file suggests room for improvement in transparency and incident readiness. Privacy compliance is well-handled with clear policies and consent mechanisms, aligning with GDPR requirements. Overall, HCPLive presents a professional and trustworthy online presence for healthcare professionals. The main risk factor is the lack of WHOIS data, which slightly reduces domain trustworthiness. Strategic recommendations include publishing explicit security and incident response policies, implementing vulnerability disclosure mechanisms, and enhancing accessibility features to further strengthen the site's security and compliance posture.

30
88
17
70
75
85
100
healthcareclinicalnewsphysiciansmedicalinformationnewsportal
Google Tag ManagerSegment AnalyticsOneTrust Consent ManagementDoubleVerify+3
2025-10-17T16:24:24.893Z
C

CGTLive®

cgtlive.com

63
HealthcareUnited StatesmediumMEDIUM

CGTLive® is a specialized healthcare media platform focused on delivering news, expert insights, and real-time coverage in the cell and gene therapy sector. The website targets healthcare professionals, researchers, and industry stakeholders interested in cutting-edge advancements in this niche field. The business model centers on providing high-quality content and information services to a specialized audience, positioning itself as a trusted source in the cell and gene therapy community. Technically, the website employs modern web technologies including Astro for static site generation, Google Tag Manager, Segment Analytics, and OneTrust for consent management. The site is well-optimized for mobile devices and demonstrates good SEO practices. Performance is moderate with room for improvement in accessibility features. The presence of cookie consent mechanisms and GDPR compliance indicators reflects a mature approach to privacy. From a security perspective, the site uses HTTPS and employs cookie consent management to control tracking. However, no explicit security headers were detected in the provided data, and no privacy or terms of service pages were found, which are areas for improvement. The absence of WHOIS data for the domain raises concerns about domain legitimacy and transparency, although the professional content and technical setup suggest a legitimate operation. Overall, CGTLive® presents a professional and trustworthy platform within its healthcare niche but would benefit from enhanced transparency in domain registration and explicit publication of privacy and terms policies to strengthen user trust and compliance posture.

30
88
17
50
75
70
100
healthcarecelltherapygenetherapymedicalnewsconsentmanagement+2 more
JavaScriptGoogle Tag ManagerSegment AnalyticsOneTrust Consent Management+1
2025-10-17T16:24:19.882Z
isprodukce.cz favicon

IS Produkce

isprodukce.cz

45
MediaCzech RepublicmediumHIGH

IS Produkce is a Czech media production company established in 2008, offering a broad range of services including commercials, films, videos, photography, and visual effects. The company emphasizes integrated production workflows covering preproduction, production, and postproduction under one roof, enabling efficient and seamless project delivery. Their website showcases a professional portfolio with references to notable clients and projects, targeting businesses and professionals seeking high-quality media content. Technically, the website is built on WordPress 6.8.3 with a modern tech stack including jQuery, Swiper.js, and Lightbox.js. It uses Cloudflare for DNS and CDN services, ensuring good performance and security. The site is mobile-optimized and includes analytics and marketing tools such as Google Analytics, Facebook Pixel, and Google Tag Manager. However, it lacks visible privacy and cookie policies, and no cookie consent mechanism is implemented, which is a compliance gap. From a security perspective, the site enforces HTTPS with excellent SSL configuration and uses Google reCAPTCHA v3 to protect forms. Despite this, it lacks security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected in the HTML content. The domain registration is consistent with the business claims, showing a legitimate and stable presence since 2008. Overall, IS Produkce presents a professional and trustworthy online presence with good technical implementation and business credibility. The main areas for improvement include enhancing privacy compliance by publishing policies and implementing cookie consent, adding security headers, and providing clear security and incident response information.

15
10
17
75
62
80
20
mediaproductionfilmvideocommercialsphotography+3 more
WordPress 6.8.3jQuery 3.7.1jQuery Migrate 3.4.1Swiper.js+5

Partner Domains:

rentalia.cz
partner
atelierzlin.cz
partner

+1 more partners

2025-10-17T16:24:04.848Z
ratibor.cz favicon

Obec Ratiboř

ratibor.cz

52
GovernmentCzech RepublicsmallMEDIUM

Obec Ratiboř operates an official municipal website serving the local community of Ratiboř in the Czech Republic. The site provides comprehensive information about local government services, community events, public notices, and contact details. It targets residents, visitors, and stakeholders interested in municipal affairs, positioning itself as a trusted source of local government information. The business model is public service oriented, focusing on transparency and community engagement. The website is well-branded, consistent, and professionally maintained with a domain age dating back to 2004, indicating a stable online presence. Technically, the website employs a modern technology stack including jQuery, Bootstrap, Swiper, and Nette Framework, supported by Google Analytics and Tag Manager for analytics. It uses HTTPS with good SSL configuration and integrates Google reCAPTCHA for form security. The site is mobile optimized, accessible, and SEO friendly, though performance is moderate. Hosting and domain registration are managed by WEDOS, a reputable Czech provider. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and bot protection. However, it lacks explicit security headers and a cookie consent mechanism, which are recommended for enhanced security and privacy compliance. There is no visible security policy or incident response contact information, which could be improved to strengthen trust and readiness. No vulnerabilities or suspicious content were detected. Overall, Obec Ratiboř's website is a secure, professional, and trustworthy municipal portal with excellent content quality and user experience. Strategic improvements in privacy compliance and security policy transparency would further enhance its security posture and user trust.

30
10
17
70
85
75
40
municipalitygovernmentcommunityeventsczechrepublic+2 more
jQuery 3.6.3Bootstrap 4.6Swiper 6.5Nette Forms and AJAX+9
2025-10-17T16:23:39.800Z
healthcarexfood.org favicon

American Heart Association

healthcarexfood.org

61
HealthcareUnited StateslargeMEDIUM

The website 'Health Care by Food' is an initiative by the American Heart Association focused on integrating food as medicine into healthcare systems. It serves as a platform for coordinating scientific research, public policy advocacy, and stakeholder education to address diet-related diseases. The site targets healthcare professionals, researchers, policymakers, and the general public interested in nutrition and health. The American Heart Association's strong brand presence and certifications enhance the site's credibility. Technically, the website employs modern web technologies including Bootstrap, Google Fonts, Coveo search framework, and integrates third-party services like Fundraise Up for fundraising and Google Tag Manager for analytics. The site is hosted likely behind Cloudflare, ensuring good performance and security. The design is responsive and accessible, with good SEO practices. From a security perspective, the site uses HTTPS with strong SSL configuration and includes security best practices such as asynchronous loading of scripts and no visible vulnerabilities. However, explicit security headers and a public vulnerability disclosure policy are not evident and could be improved. Privacy compliance is well addressed with clear privacy and cookie policies, including GDPR considerations. Overall, the website is trustworthy, professional, and well-maintained, reflecting the stature of the American Heart Association. The lack of WHOIS data is due to privacy protection, which is justified for this type of organization. No blocking or WAF challenges were detected, allowing full content access and analysis.

35
53
2
50
75
85
100
healthcarenutritionnon-profitfoodismedicineamericanheartassociation+2 more
Bootstrap IconsGoogle Fonts (Montserrat)Coveo Atomic Search FrameworkFundraise Up widget+2

Partner Domains:

www.heart.org
parent
www.stroke.org
sister

+1 more partners

2025-10-17T15:20:17.036Z
empoweredtoserve.org favicon

American Heart Association

empoweredtoserve.org

67
HealthcareUnited StatesenterpriseMEDIUM

EmPOWERED to Serve is a community-focused initiative under the American Heart Association aimed at empowering local communities through health education, economic mobility, and opportunity. The website serves as a platform to provide resources, programs, and volunteer opportunities to diverse audiences including students, entrepreneurs, and community leaders. The brand is strongly aligned with the reputable American Heart Association, enhancing its credibility and trustworthiness. Technically, the website employs modern web technologies such as Bootstrap, Sitecore CMS, and integrates multiple analytics and marketing tools including Google Tag Manager, Facebook Pixel, and Hotjar. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Privacy and cookie policies are implemented with consent mechanisms, reflecting compliance with GDPR and related regulations. From a security perspective, the site uses HTTPS with strong SSL configuration and security headers. However, it lacks publicly available security policies and incident response information, which could be improved to enhance transparency and trust. No vulnerabilities or suspicious content were detected during analysis. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. Strategic recommendations include publishing a security policy, establishing a vulnerability disclosure program, and providing incident response contacts to further strengthen security posture and user trust.

35
88
17
50
75
85
100
healthcommunitynon-profiteducationvolunteer+1 more
Bootstrap IconsGoogle Fonts (Montserrat)Google Tag ManagerFacebook Pixel+4

Partner Domains:

heart.org
partner
stroke.org
partner

+2 more partners

2025-10-17T15:20:11.701Z